SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001674 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001674
Domain Number 1 Region: 562-811
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.04e-84
Family Eukaryotic proteases 0.0000000693
Further Details:      
 
Domain Number 2 Region: 374-469
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-39
Family Kringle modules 0.0000102
Further Details:      
 
Domain Number 3 Region: 96-190
Classification Level Classification E-value
Superfamily Kringle-like 7.27e-36
Family Kringle modules 0.0000304
Further Details:      
 
Domain Number 4 Region: 280-365
Classification Level Classification E-value
Superfamily Kringle-like 1.57e-34
Family Kringle modules 0.0000164
Further Details:      
 
Domain Number 5 Region: 191-273
Classification Level Classification E-value
Superfamily Kringle-like 1.16e-33
Family Kringle modules 0.0000117
Further Details:      
 
Domain Number 6 Region: 474-568
Classification Level Classification E-value
Superfamily Kringle-like 3.77e-33
Family Kringle modules 0.0000137
Further Details:      
 
Domain Number 7 Region: 26-107
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.92e-21
Family Hairpin loop containing domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001674   Gene: ENSBTAG00000001271   Transcript: ENSBTAT00000001674
Sequence length 812
Comment pep:known chromosome:UMD3.1:9:98016586:98064203:-1 gene:ENSBTAG00000001271 transcript:ENSBTAT00000001674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPASPKMEHKAVVFLILLFLKSGLGDLLDDYVNTQGASLLSLSRKNLAGRSVEDCAAKC
EEETDFVCRAFQYHSKEQQCVVMAENSKNTPVFRMRDVILYEKRIYLLECKTGNGQTYRG
TTAETKSGVTCQKWSATSPHVPKFSPEKFPLAGLEENYCRNPDNDENGPWCYTTDPDKRY
DYCDIPECEDKCMHCSGENYEGKIAKTMSGRDCQAWDSQSPHAHGYIPSKFPSKNLKMNY
CRNPDGEPRPWCFTTDPQKRWEFCDIPRCTTPPPSSGPKYQCLKGTGKNYGGTVAVTESG
HTCQRWSEQTPHKHNRTPENFPCKNLEENYCRNPNGEKAPWCYTTNSKVRWEYCTIPSCE
SSPLSTERMDVPVPPEQTPVPQDCYHGNGQSYRGTSSTTITGRKCQSWSSMTPHRHLKTP
ENYPNAGLTMNYCRNPDADKSPWCYTTDPRVRWEFCNLKKCSETPEQVPAAPQAPGVENP
PEADCMIGMGKSYRGKKATTVAGVPCQEWAAQEPHHHSIFTPETNPQSGLERNYCRNPDG
DVNGPWCYTMNPRKLFDYCDVPQCESSFDCGKPKVEPKKCSGRIVGGCVSKPHSWPWQVS
LRRSSRHFCGGTLISPKWVLTAAHCLDNILALSFYKVILGAHNEKVREQSVQEIPVSRLF
REPSQADIALLKLSRPAIITKEVIPACLPPPNYMVAARTECYITGWGETQGTFGEGLLKE
AHLPVIENKVCNRNEYLDGRVKPTELCAGHLIGGTDSCQGDSGGPLVCFEKDKYILQGVT
SWGLGCARPNKPGVYVRVSPYVPWIEETMRRN
Download sequence
Identical sequences E1B726
ENSBTAP00000051417 ENSBTAP00000001674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]