SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001704 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001704
Domain Number 1 Region: 354-707
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.43e-142
Family Transferrin 0.00000000000238
Further Details:      
 
Domain Number 2 Region: 21-351
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.86e-126
Family Transferrin 0.00000000000676
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001704   Gene: ENSBTAG00000001292   Transcript: ENSBTAT00000001704
Sequence length 708
Comment pep:known chromosome:UMD3.1:22:53521906:53556089:1 gene:ENSBTAG00000001292 transcript:ENSBTAT00000001704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLFVPALLSLGALGLCLAAPRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRAF
ALECIRAIAEKKADAVTLDGGMVFEAGRDPYKLRPVAAEIYGTKESPQTHYYAVAVVKKG
SNFQLDQLQGRKSCHTGLGRSAGWIIPMGILRPYLSWTESLEPLQGAVAKFFSASCVPCI
DRQAYPNLCQLCKGEGENQCACSSREPYFGYSGAFKCLQDGAGDVAFVKETTVFENLPEK
ADRDQYELLCLNNSRAPVDAFKECHLAQVPSHAVVARSVDGKEDLIWKLLSKAQEKFGKN
KSRSFQLFGSPPGQRDLLFKDSALGFLRIPSKVDSALYLGSRYLTTLKNLRETAEEVKAR
YTRVVWCAVGPEEQKKCQQWSQQSGQNVTCATASTTDDCIVLVLKGEADALNLDGGYIYT
AGKCGLVPVLAENRKSSKHSSLDCVLRPTEGYLAVAVVKKANEGLTWNSLKDKKSCHTAV
DRTAGWNIPMGLIVNQTGSCAFDEFFSQSCAPGADPKSRLCALCAGDDQGLDKCVPNSKE
KYYGYTGAFRCLAEDVGDVAFVKNDTVWENTNGESTADWAKNLNREDFRLLCLDGTRKPV
TEAQSCHLAVAPNHAVVSRSDRAAHVKQVLLHQQALFGKNGKNCPDKFCLFKSETKNLLF
NDNTECLAKLGGRPTYEEYLGTEYVTAIANLKKCSTSPLLEACAFLTR
Download sequence
Identical sequences B9VPZ5 J7K1V4 P24627
ENSBTAP00000001704 NP_851341.1.59421 NP_851341.1.76553 XP_015315141.1.76553 9913.ENSBTAP00000001704 ENSBTAP00000001704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]