SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001716 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001716
Domain Number 1 Region: 32-277
Classification Level Classification E-value
Superfamily L domain-like 7.94e-42
Family Ngr ectodomain-like 0.039
Further Details:      
 
Domain Number 2 Region: 313-576
Classification Level Classification E-value
Superfamily L domain-like 3.83e-40
Family Internalin LRR domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001716   Gene: ENSBTAG00000001301   Transcript: ENSBTAT00000001716
Sequence length 662
Comment pep:known_by_projection chromosome:UMD3.1:15:56827092:56834190:-1 gene:ENSBTAG00000001301 transcript:ENSBTAT00000001716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHQILLLLAVLTLGLATSQHRDKVPCRKVDKEVWCQGRGLLQVPSVLSRDIEVLNLSRN
QLRSILALPLGFYTALRHLDLSANEISFLQPGVFQALPHLEHLNLAHNHLAVGTALNTGG
LGPLLHLTSLDLSGNSLYSGLVEQLLGEAPALRTLSLAENSLTRLGRRTFLSTPALERLD
LHSNVLMDIEDGAFEALPRLVHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTAEPR
AEYQLAWLDLRENKLLHFPDLSALPRLIYLNASNNLIRLPAEPPRGGAEGLHAPSEGWSS
LPLSNPSRNTSTQPLSQLLNLDLSYNEIELVPEGFLEPLTSLRSLNLSRNCLRAFEAQPG
SLPCLTLLDISHNALETLELGARALGSLRTLLLQDNALRDLPLYTFTSLASLQRLNLQGN
RLSPCGGPAEPGPSGCVAFSGISSLRVLNLADNEMEILQAGAFLHTPLAELDLSSNPGLD
VAPGALAGLEGSLEVLALQGNGLAVLQVDLPCFSCLKRLNLAENRLSRLPAWTQAVSLEV
LDLRNNSFSLLPGSAMGGLENSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLIC
RFGSQEEVSLSHVRPEDCEKGGLKNINLIIILTFAVVSAILLTTLATCCCVRRQKFSQQY
KA
Download sequence
Identical sequences E1BAW2
9913.ENSBTAP00000001716 ENSBTAP00000001716 ENSBTAP00000001716 NP_001180004.1.59421 NP_001180004.1.76553 XP_005216375.1.76553 XP_010811054.1.76553 XP_010811056.1.76553 XP_015330300.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]