SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001802 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001802
Domain Number 1 Region: 22-127
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00000363
Further Details:      
 
Domain Number 2 Region: 138-245
Classification Level Classification E-value
Superfamily POZ domain 0.000000102
Family BTB/POZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001802   Gene: ENSBTAG00000001368   Transcript: ENSBTAT00000001802
Sequence length 555
Comment pep:known chromosome:UMD3.1:19:54035259:54045168:1 gene:ENSBTAG00000001368 transcript:ENSBTAT00000001802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLRLFWIWLLVVGTRGVKDGDMRLADGGSANQGRVEIYYNGQWGTVCENMWDLTDASV
VCRALGFQNATEALGGAAFGPGYGPIMLDEVRCTGTEPSLANCSSLGWMRSNCRHDKDAS
VICTNETRGVYTLDLSGELPAALEQIFESQKGCDLFITVKVREEDEIAMCAHKLILSTNP
EAHGLWKEPGSRVTMEVDAECVPVVKDFIRYLYSRRIDVSLSSVKCLHKLASAYQAKQLQ
SYCGHLFAILIPQDPSFWTPLELYAYALATRDPVLEEICVQFLAWNFGALTQAEAWPSVP
PALLQGLLSRTELVVPSELVLLLAVDKWSQERRTSHKEVEALVGQVRFPMMPPQDLFSLQ
FNLSLYWSHEALFQKKILQALEFHTVPFELLAQYWGLNLTEGTYQPRLYTSPTWSQSVMS
SSYNPSRSFQTPQHPSFLFHDSSVSWSFVYLPTLQSCWNYGFSCSSDDPPLLALSKSSYS
KSNPTIGYENRALLHCEGSFVVDVIDFKGWKALVPSALATNSSRSTSLFPCPSGVFSRFQ
VVIRPFYLTNSTDMD
Download sequence
Identical sequences A7E3W2
ENSBTAP00000001802 ENSBTAP00000001802 9913.ENSBTAP00000001802 XP_005221293.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]