SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001939 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001939
Domain Number 1 Region: 81-261
Classification Level Classification E-value
Superfamily vWA-like 6.12e-39
Family Integrin A (or I) domain 0.00087
Further Details:      
 
Domain Number 2 Region: 1427-1625
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-37
Family Pentraxin (pentaxin) 0.00072
Further Details:      
 
Domain Number 3 Region: 1789-1858
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-19
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 4 Region: 3241-3310
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.37e-19
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 5 Region: 2833-2902
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 2775-2844
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1847-1916
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 8 Region: 2146-2215
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 9 Region: 1963-2031
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 10 Region: 2381-2451
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-17
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 11 Region: 2718-2786
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.76e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 12 Region: 3065-3132
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.29e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 13 Region: 1684-1747
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.31e-16
Family Complement control module/SCR domain 0.00057
Further Details:      
 
Domain Number 14 Region: 2556-2623
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 15 Region: 2891-2960
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.64e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 16 Region: 2440-2509
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.06e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 17 Region: 3418-3477
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000131
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 3299-3366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 19 Region: 1905-1970
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 20 Region: 2498-2561
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000306
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 21 Region: 2674-2728
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000361
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 22 Region: 2265-2333
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000005
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 23 Region: 1220-1352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000133
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 24 Region: 1629-1701
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000695
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 25 Region: 435-496
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000709
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 26 Region: 3009-3074
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000639
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 27 Region: 2949-3014
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000653
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 28 Region: 2204-2269
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000126
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 29 Region: 3359-3427
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000138
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 2324-2392
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 31 Region: 2020-2088
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000292
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 32 Region: 3123-3188
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000778
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 33 Region: 378-449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000931
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 34 Region: 989-1133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000266
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 35 Region: 1385-1424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000532
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 36 Region: 2085-2152
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000167
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 37 Region: 3182-3233
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000306
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 38 Region: 1347-1389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 39 Region: 1743-1786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000225
Family EGF-type module 0.033
Further Details:      
 
Domain Number 40 Region: 499-557
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000361
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 41 Region: 1197-1231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000238
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 42 Region: 279-419,465-483
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000879
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001939   Gene: ENSBTAG00000020243   Transcript: ENSBTAT00000001939
Sequence length 3573
Comment pep:known_by_projection chromosome:UMD3.1:8:101588109:101799168:-1 gene:ENSBTAG00000020243 transcript:ENSBTAT00000001939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWARLAFCCWGLALVSGWATFQQLSPSRNFSFRLFPEAAPGAPGRLPEPPAPSEDAAAAE
SKVERLGQAFRRRVRRLRELSERLELVFLVDESSSVGQANFLSELKFVRKLLSDFPVVPT
ATRVAIVTFSSKNNVVPRVDYISSRRAHQHKCALLSREIPAITYRGGGTYTKGAFQQAAQ
ILRHSRENSTKVIFLITDGYSNGGDPRPIAASLRDFGVEIFTFGIWQGNIRELNDMASIP
KEEHCYLLHSFEEFEALARRALHEDLPSGSFIQEDMSHCSYLCEAGKDCCDQMASCKCGT
HTGQFECICEKGYYGKGLQYECTACPSGTYKPEGSPGGISTCLPCPDENHTSPPGSTSPE
DCVCKEGYQASGQTCKVVHCPALKPPENGYFIRNTCNNHFNAACGVRCHPGFDLVGSSIF
LCLPSGLWSSSESSCRVRTCPRLRQPKHGRLSCSAGEMSYRTMCLVTCDEGYRLEGSARL
TCQVNAQWDGPEPRCVVERYCATFQKPKGVTLSPPNCGRHPAKPGTICQLSCRQGFILSG
GREEVRCTTSGKWSAKVQTAACKDVEAPQINCPADIEAETQEQQDSANITWQIPTAKDNS
GEKVSIHVHPAFTPPYLFPIGDVAVTYTATDPSSNQASCTFHIKVIDVEPPSIDWCRSPP
PVQVSEKEHAVTWDEPQFSDNSGAMLTITRSHTPGDLFPQGETIVRYTATDPSGNNRTCD
IHIVVKGSPCEVPFTPVNGDFVCTQDSTGVNCSLSCLEGYDFTEGSTDKYYCAYEDGIWK
PPYSTEWPDCAIKRFANHGYKSFEMLYKATRCDDTDLLKKFSEAFETTLGKMVPSFCSDA
DDIDCRLEDLTKKYCLEYNYDYENGFAIGPGGWSAANRLDYSYGDFQDTVRETPTGAGKA
RSSRIERSAPLSDHKIRLIFNITASVPLPDERNDTLELENQQRLIKTLETITNRLKRTLT
KEPMYSFQLASEMLVADSNSLETEKAFLFCRPGSVLRGRMCVNCPLGTYYSLEHSVCESC
LMGSYQDEEGQLECKPCPTGTYTEYLHSRSSSECKAQCKQGTYSSNGLETCESCPLGSYQ
PAFGSRGCLSCPENTSTVKRGAVDISACGVPCPVGEFSRSGLMPCYPCPQDYYQPNPGKS
FCLSCPFYGTTTITGARSITDCSSFSSTFSAAEESAVLLASPGHVKKKYEVSSQVFHECF
LNPCYNGGTCQQLGRGYVCVCLPGYTGLKCEIDIDECSSLPCHNNGICKDRVGEFICECP
SGYTGQLCEDNVNECISSPCLNKGTCVDGLAGYHCTCVKGYMGLHCETEVNECQSSPCLN
NAVCEDQLGGFLCKCPPGFLGTRCDINMDECLSQPCKNGATCKDGANGFRCQCAAGFTGT
HCELNIDECQSNPCKNQATCVDELNAYSCKCQPGFSGSRCETEQSAGFNLDFEVSGIYGY
IMLDGVLPTLHAVTCTFWMKSSDDINYGTPISYALENGSDNTFLLTDYNGWVLYVNGKEK
ITDCPSVNDGNWHHIAITWTSTGGAWKVYIDGNLSDGGMGLSIGSPIPGGGALVIGQEQD
KKGEGFNPAESFVGSISQLNLWDYVLSPQQVKSLATSCPEELSKGNVLAWPDFLSGIVGR
VKINPKSIFCSDCPSLEGSVPHLRTASRDVKPGSKISLFCDPGFQMVGNSVQYCLNQGQW
TQPLPRCERISCGVPPPLENGFYSAEDFHAGSTVTYQCNNGYYLLGDSRMFCTDNGSWNG
ISPSCLDVDECAVGSDCSEHASCLNTNGSYVCSCIPPYTGDGKNCAEPIKCKTPGNPENG
HSSGETYTVGAEVTFSCEEGYQLVGAARITCLESGEWSHLIPYCEAVSCGAPALPENGGV
DGSAFTYGNKVIYRCNKGYTLEGEKESSCLASGSWSQSPPVCELVKCSSPEDVNHGNYIL
SGLTYLSTASYSCDNGYSLQGPSVIECSASGSWDRAPPTCHLVSCGEPPAIKDAVTTGSN
FTFGNTVTYACREGYTLAGPDTIECLASGKWSRSDQQCLAVSCDEPPSVEHASPETAHRL
FGDIAFYYCSDGYSLADNSQLLCNAQGKWVPPEGQAMPRCIAHFCEKPPAVSYSILESVS
KAKFAAGSVVSFKCMEGFVLNTSAKIECLRGGQWSPSPMSIQCIPVRCGEPPRILNGYAI
GSNYSFGAMVAYSCNRGFYIKGEKKSACEATGRWGSPTPTCHPVSCAEPPKVENGFLEHT
TGRTFESEVRYQCNPGYKSVGSPVFVCQANRHWHSESPLACIPLNCGKPPPIQNGYTKGE
NFEVGAKVHFFCNEGYELIGEHSWTCLKSGKWNKKPNQKCVPAKCPEPPLLENQLVLKEL
TTEVGVVTFSCKEGHVLQGRSVLRCLPSQQWNDSFPVCKMVLCLPPPLISFGVPAPSSAL
HFGSTVKYSCVDGFFLKGDPTTSCQADGTWSSPLPECVPVECPQPEEILNGIIDVQGLAY
LSTALYTCKPGFELVGNTTTLCGENGHWLGKKPTCKPIECPKPKEILNGKLSYTKLHYGQ
TITYSCDRGFRLEGPKALTCLETGDWDVDVPSCNAIHCDPPQPIENGFVEGADYSYGAMI
IYSCFPGFQVAGHAMQTCEESGWSSSIPTCVPIDCGLPPHIDFGDSTVVRDGQGYFNQED
DMMEVPHVTPHPPHPLGTVAKIWGNTKGSPAMHSAKFPYNTLVSYSCNPGYELLGNAVLI
CQEDGTWNGSAPSCISMECDLPVAPENGFLHVTETTTGSAVQYSCKPGHTLVGSDLRLCL
RNREWSGASPRCEAISCPKPNPVTDGSIRGSNYSYLSVLYYECNSGYVLNGSSRRTCQED
KTWDGDEPVCIPVDCGSPPSSANGQVKGEEYTFQKEVQYTCNTGFLLEGASSRVCLADGS
WSGNTPICVPVRCAPPSQVANGVMDGLDYGFGKEVVFHCQDGYALHGAPKLTCQSNGNWD
AQVPFCKPVNCSPPEDLDRGFPNGFSLYRGGQIEYQCFPGYKLHGSPSRKCLSNSSWSGS
PPSCLPCKCSPPTIQSGAVNGTDFSCGKAAQIRCFKGFQLLGLSEITCEADGQWSSDFPR
CEHPSCGSPPTIPNAFIVERGSLEENVITYTCKPGYVIQGSSDLICTEKGTWSQPYPVCE
PLSCGPPPSVSNAVATGEAHTYESQVRLRCLEGYVMDTDIDTFTCQKDGHWFPETISCSP
KKCPLPTNVTHILVHGDDFSVNKQVSVSCVEGYTYEGVNTSTCQLDGTWEPPFSDESCSP
ISCGKPESPEHGFVFGSEYNFESTITYHCETGYELEGSRERVCQENGQWTGGVATCKKIM
CEAPLKFLNGKAEVENSTAGPSVIYSCNRGYSLEGAPEASCTENGTWSHPVPLCKPNPCP
VPFVIPENAVLSEKEFYVDQNVSIKCREGFLLRGQSTITCNPDETWTQTSAKCEKISCGP
PTHVENAIARGVHYQYGDVITYSCYSGYMLEGSLRSVCLENGTWTSPPVCRAVCRFPCQN
GGICQRPNACSCPDGWMGRLCEEPICILPCLNGGRCVAPYQCDCSPGWTGSRCHTAVCQS
PCLNGGKCVRPNRCHCLSAWTGHDCSRTKRKGL
Download sequence
Identical sequences F1MNH3
ENSBTAP00000001939 ENSBTAP00000001939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]