SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002011 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002011
Domain Number 1 Region: 39-231
Classification Level Classification E-value
Superfamily L domain-like 2.38e-25
Family Ngr ectodomain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002011   Gene: ENSBTAG00000001537   Transcript: ENSBTAT00000002011
Sequence length 344
Comment pep:known chromosome:UMD3.1:15:56961320:56974713:1 gene:ENSBTAG00000001537 transcript:ENSBTAT00000002011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWPLLPLLLLLLLAASGAQTTRPCFPGCQCEVETFGLFDSFSLTRVGCSGLGPHIVPVP
IPLDTAHLDLSSNRLETVNESVLAGPGYTTLSGLDLSYNLLTSLSPTAFSRLRYLESLDL
SHNGLAALPTGSFTSSPLSDVNLSHNRLREVSVSAFATHSQGRALHVDLSHNLLQRLLPH
SSRAGQPAPTIQSLNLAWNRLRAVPDLRGLPLRYLSLDGTRWQPSAPAPLRGWRASLICR
WAACRVSPCWRPTASTSCRACRSWTCPATPGSNGQDLRCSQAWAPCRSWTCRAQAWCPCP
RSCSSTSPHCRASAWARACSAGAWCGRAPTHGSLASPPRWPCTA
Download sequence
Identical sequences A7E318
ENSBTAP00000002011 NP_001096738.1.59421 NP_001096738.1.76553 9913.ENSBTAP00000002011 ENSBTAP00000002011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]