SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002052 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002052
Domain Number 1 Region: 1213-1488
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.51e-57
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 229-478,507-577
Classification Level Classification E-value
Superfamily L domain-like 2.89e-42
Family Leucine rich effector protein YopM 0.029
Further Details:      
 
Domain Number 3 Region: 26-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.35e-17
Family Ankyrin repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 605-793
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000024
Family G proteins 0.011
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000002052
Domain Number - Region: 1558-1630,1658-1751
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000152
Family WD40-repeat 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002052   Gene: ENSBTAG00000001567   Transcript: ENSBTAT00000002052
Sequence length 1984
Comment pep:known_by_projection chromosome:UMD3.1:21:5642546:5734611:-1 gene:ENSBTAG00000001567 transcript:ENSBTAT00000002052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPGAGDMGSKLSMPGSEPMVQSPRTEGIHAAYRRGNISRAQHLLREACDESTSQLEKGQL
LSISAAHGDLETVRYLLTERLVELPTEPTDDNPAVVAAQFGHTDVVQELLESLPGPCSPQ
RLLNWMLALACQQGHLAVVKLLVLTYGADPESYAVRKNEFPVIVRLPLYAAIKSGNEDIA
IFLIRHGAFFCSYILLDSPDPSKHLLRKYFVEASALPSSCPGKMALRVKWSHLKLPWVDL
DWLIDISCQITELDLSANCLASLPSVVPWGLINLRKLNLSDNHLGELPSVQSSDEIICSR
LLEIDISSNKLSHLPPGFLHLSKLQKLTASKNYLEKLFEEESATNWIGLRKLQELDVSDN
KLTELPALFLHSFKSLSCLNVSRNNLKAFPDAWACPLKCCKASKNALESLPDKMAVFWKN
HLKDVDFSENALKEVPLGLFQLDALMFLKLQGNQLVALPPQEKWTCRQLKTLDLSRNHFG
KNEDVLKTKRISFFTTRGRQRSGTEAACVLEFPAFLSESLEVLCLNDNHLDAVPPSVCLL
KSLSELYLGNNPSLRELPPELGQLGNLWQLDIEDLNIINVPAEIRKEGPKAMLSYLRAQL
RKAEKCKQMKMIIVGPPRQGKSTLLEILQTGRAPQVVHSEATIRTTKWELQRPAGSRAKV
ESVEFTVWDIGGPASMATVNQCFFTDKALYVVVWNLALGEEAVASLQFWLLNIEAKAPNA
VVLVVGTHLDLIETKFRVERIATLRAYVLALCRSPSGSRATGFPDITCKHLHELSCKSLE
GQEGLRQLIFQVTCNMKDVGSTIGCQRLAGRLIPRSYLSLQEAVLAEKQHRSLSDDVQYL
TDRQLEQLVDQMPCSDIQDYEDLQSAISFLIETGSLLHFPDTSHGLRNLYFLDPIWLSEC
LQRIFNIKGSRSVAKNGVIRAEDLRLLLVGTGFTKQTEEQYFQFLAKFEIALPVANDSYL
LPHLLPSKPGLDTHGMRHPTANTIQRVFKMSFVPVGFWQRFIARMLISLAEMDLQLFENR
KNTKSRHRKVTIYSFTGNQRNRCSTFRVKRNQTIYWQEGLLVTFDGGYLSVESSDVNWKK
KKSGGIKIMCQSEIRDFSAMAFITDHVNSLIDQWFPALTATESDGTPLMEQYVPCPVCEA
SWAQHSNPSERSEDVQYFDMEDCVLTAIERDFISCPRHPDLLVPLQELVPELFMTDFPAR
LFLDNSKLEHSEDESAVLGQGGSGTVIYRARYQGQPVAVKRFQIKKFKNYANAPADTMLR
HLRATDAMRNFSEFRQEASMLHALQHPCIVSLIGISIHPLCFALELAPLGSLNTVLSENA
RDSSFMPLGHMLTQKIAYQIASGLAYLHKKNIIFCDLKSDNILVWSLDIKEHINIKLSDY
GISRQSFHEGALGVEGTPGYQAPEIRPRIVYDEKVDMFSYGMVLYELLSGQRPALGQHQL
QISKKLSKGIRPVLGQPEEVQFHRLQALMMECWDTKPEKRPLALAVVSQMKDPTFATFMY
QLPCGKQTSFFSSQGQEYMVVFWEGKEESRNYTVVNTEKGLLEVQHMSCAGMKLSCQLKI
QNSLWTATEDQKIYIYSLKGMCPLNTPQRALDTPAIVTCFLAVPIIKKNSHLVLAGLADG
LVAVFPAAWGAPDYGCSYLCSHTANRAKFSIPDEDARQNPYPVTAMEVVNCGSEVWYSNG
PGLLVIDCAALEIRRRLEPYAAPSVVTSVVCGSECRGEEVVWCLDDRANCLVLYHSATYQ
LCARYFCGDPSPLGDVFPVCPMGPPPLDSPTASTREPARGSIADVSFMFSEELGTQILTH
QDSLTDYCSLSSCSAASPHPAPMALSSLPCSPASSASLPFSSDCEDTSQLPKPAVGSDRS
VHDLSPVDGEAFSQHLQAVKILAVKDVIWVPRRGGDIIVISLEKEAGTQRGRVIAVLKAR
ELTPHGVLTEAAVVAKDTVVCGFENENLEWCLAVWRGWGTQEFDIFYQSYEELGRLEACV
RKRR
Download sequence
Identical sequences F1N6C1
9913.ENSBTAP00000002052 ENSBTAP00000002052 ENSBTAP00000002052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]