SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002071 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002071
Domain Number 1 Region: 48-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-72
Family Calnexin/calreticulin 0.0000000363
Further Details:      
 
Domain Number 2 Region: 256-394
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.83e-57
Family P-domain of calnexin/calreticulin 0.00000031
Further Details:      
 
Domain Number 3 Region: 397-441
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000538
Family Calnexin/calreticulin 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002071   Gene: ENSBTAG00000001580   Transcript: ENSBTAT00000002071
Sequence length 606
Comment pep:known chromosome:UMD3.1:17:17575019:17620096:1 gene:ENSBTAG00000001580 transcript:ENSBTAT00000002071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFQGFWLCLGLLFISVNAEFMDDSVEMEDFDENSEETDELSSEIKYKTPQPVGEVYFTE
TFDSGRLAGWVLSKAKKDDIDAEISIYDGRWEIEELKENRIPGDRGLVLKSRAKHHAISA
VLAKPFIFADKPLVVQYEVNFQDGIDCGGAYIKLLADTDGLNLENFYDKTSYTIMFGPDK
CGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKRFFTDRKTHLYTLVMNPDDTFEVLID
QIVVNKGSLLEDVVPPINPPKEIEDPTDEKPDDWDERAKIPDASAVKPEDWDESEPPQIV
DSSAVKPDGWLDNEPEFIPDPNAEKPFDWNEDMDGEWEAPHISNPACRIGCGEWSPPMID
NPKYKGIWRPPMIDNPNYQGIWSPRKIPNPDYFEDNHPFLLTSFRALGLELWSMTSDIYF
DNFIICSEKEVADRWAADGWGMKILIENANEPSIFKQLMSATEQRPWLWFIYLLTAALPI
ALIGSFCWPRKVKKKYEDVAFEKLDICKPQTKGALEQEVKEEKAALEKPVDLEEEKKQSD
GEIVEKEEEGEPEEKSEEEIEIIEGQEEGNKSNKSGSEDEMKEADESTGSGDGPIKSVRK
RRVRKE
Download sequence
Identical sequences Q3SYT6
ENSBTAP00000002071 NP_001029377.1.59421 NP_001029377.1.76553 ENSBTAP00000002071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]