SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002191 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002191
Domain Number 1 Region: 360-488
Classification Level Classification E-value
Superfamily Plus3-like 5.1e-46
Family Plus3 0.00000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002191   Gene: ENSBTAG00000001671   Transcript: ENSBTAT00000002191
Sequence length 714
Comment pep:known_by_projection chromosome:UMD3.1:10:36980593:37025485:1 gene:ENSBTAG00000001671 transcript:ENSBTAT00000002191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGRLCVGRTAAAAAAATAAVAVPLAGGQEGSPGGVRRGSRGTTMVKKRKGRVVIDSDTE
DSGSDENLDQELLSLAKRKRSDSEEKEPPVSQPAASSDSETSNSDDEWTFGSNKNKKKGK
ARKIEKKGTMKKQANKTASSGSSDKDSSAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDE
EFHDGYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKKRFEIRKKLKTAKKKEK
KEKKKKQEEEQEKKKLTQIQESQVTSHNKERRSKRDEKLDKKSQAMEELKAEREKRKNRT
AELLAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTTSSDEEEEKEEIPPKSQPVSLP
EELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQ
LGGTRTNKGLQLRHGSDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKE
LSIKEALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQLLKEKAMAEDLGDQDKAKQIQ
DQLNELEERAEALDRQRTKNISAISYINQRNREWNIVESEKALVAESHNMKNQQMDPFTR
RQCKPTIVSNSRDPAVQAAILAQLNAKYGSGVLPDAPKEMNKGQGKDKDLNSKSASDLSE
DLFKVHDFDVKIDLQVPSSESKALAITSKAPPAKDGAPRRSLNLEDYKKRRGLI
Download sequence
Identical sequences F1N6E9
ENSBTAP00000002191 ENSBTAP00000002191 NP_001179414.1.59421 NP_001179414.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]