SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002199 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002199
Domain Number 1 Region: 36-230
Classification Level Classification E-value
Superfamily L domain-like 2.31e-35
Family Ngr ectodomain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002199   Gene: ENSBTAG00000001686   Transcript: ENSBTAT00000002199
Sequence length 320
Comment pep:known chromosome:UMD3.1:3:3425059:3446915:-1 gene:ENSBTAG00000001686 transcript:ENSBTAT00000002199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLASDPRPGWLLFSFGMVLVSGSKCPNNCQCQDQEVICTGIQLTEYPSDIPLNTRRLYL
NDNKIRFLPAMNLGLLSDLVYLDCQKNRIQEVMDYTFVGVFRLIYLDLSFNNLTFISPYS
FSMLSNLLQLNISNNPHLLSLNKYTFANTSSLRYLDLRNTGLQTLDEAAFQNLITLQTLY
LSGNPWKCNCFFLDFTIYLIVSHLNYPDEQNATCVEPTELAGWPITKVGNPLRYMCITNL
DLQDYIFLLLISFCIFCAGTVAAWLTGVCAVLYQNACRKSSEDEVEEEEAENEDEQRVEV
SRRIFHSRVDSGHDGFPQLI
Download sequence
Identical sequences E1BBW3
ENSBTAP00000002199 NP_001193028.1.59421 NP_001193028.1.76553 XP_019813879.1.53367 9913.ENSBTAP00000002199 ENSBTAP00000002199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]