SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002276 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002276
Domain Number 1 Region: 234-432
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.06e-48
Family Reprolysin-like 0.00022
Further Details:      
 
Domain Number 2 Region: 449-525
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.22e-19
Family Blood coagulation inhibitor (disintegrin) 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000002276
Domain Number - Region: 680-707
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002276   Gene: ENSBTAG00000001735   Transcript: ENSBTAT00000002276
Sequence length 765
Comment pep:known_by_projection chromosome:UMD3.1:19:45113921:45131794:1 gene:ENSBTAG00000001735 transcript:ENSBTAT00000002276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPHRWASVCSHGLLSPGVGTWGPAGALRWRVSPHLGGPEAPEITEPSRLVGESSGGEVRK
QQLDTRVRQEPPGGPPVHLAQVRKKIPAFISNFTLDLELNHHLLSSQYVERHFSREGLTQ
HSTGAGDHCYYQGKLRGNPHSFAALSTCQGLHGVFSDGNFTYIVEPREMAGPWENAQGPL
PHLIYRTPLLPAPLGCREPGCLFAAPDHPAPLNRPRLRRKRQVRRGHPTVHSETKYVELI
VINDHQLFGQMRQSVVLTSNFAKSVVNLADVMYKEQLNTRIVLVAMETWADGDKIQVQDD
LLETLARLMVYRREGLPEASDATHLFSGRTFQSTSSGAAYVGGICSLSRGGGVNEYDNMG
AMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDNWLGCIMEDTGFYLPRKFSRCSIDEYNQ
FLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLTHDAM
CSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQGRCYG
GRCKTRDRQCQALWGHAAADRFCYEKLNVEGTERGNCGRKGSGWVQCNKQDVLCGFLLCV
NISGAPRLGDLGGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDH
RCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGET
ERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRSGGA
Download sequence
Identical sequences F1N5I4
ENSBTAP00000002276 9913.ENSBTAP00000002276 ENSBTAP00000002276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]