SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002279 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002279
Domain Number 1 Region: 40-334
Classification Level Classification E-value
Superfamily L domain-like 5.27e-46
Family Ngr ectodomain-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002279   Gene: ENSBTAG00000001745   Transcript: ENSBTAT00000002279
Sequence length 342
Comment pep:known chromosome:UMD3.1:5:21037443:21044658:-1 gene:ENSBTAG00000001745 transcript:ENSBTAT00000002279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLGVFPLLLALIGGASSTYPDYYEYYDFPQALYGRSSPNCAPECNCPESYPSAMYCDEL
KLKSVPMVPPGIKYLYLRNNQIDHIDDKAFENVTDLQWLILDHNLLENSKIKGKVFSKLK
QLKKLHINYNNLTESVGPLPKSLVDLQLTNNKISKLGSFDGLVNLTFIHLQHNQLKEDAV
SAALKGLKSLEYLDLSFNQMTKLPSGLPVSLLTLYLDNNKISNIPDEYFKRFSALQYLRL
SHNELADSGVPGNSFNVSSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCK
ILGPLSYSKIKHLRLDGNHITQTSLPPDMYECLRVANEITVN
Download sequence
Identical sequences Q05443
ENSBTAP00000002279 ENSBTAP00000002279 9913.ENSBTAP00000002279 NP_776359.1.59421 NP_776359.1.76553 XP_005206099.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]