SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002336 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002336
Domain Number 1 Region: 98-275
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.89e-63
Family F-box associated region, FBA 0.0000176
Further Details:      
 
Domain Number 2 Region: 5-71
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000441
Family F-box domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002336   Gene: ENSBTAG00000001783   Transcript: ENSBTAT00000002336
Sequence length 279
Comment pep:known chromosome:UMD3.1:18:48909650:48919627:-1 gene:ENSBTAG00000001783 transcript:ENSBTAT00000002336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARPSRRRRLPADPPIALDALPPELLVQVLSHVPPRALVMRCRPVCRAWRDVVDGPTVW
LLQLARDRSAEGRALYSVAQRCPPNSEDEEEFPLCALARYCLRAPLGRNLIFNSCGEQGF
RGWEVEHGGNGWAVEKNLIMMPGAPSQTCFVTSFEWCFKRQLVDLVMEGVWQELLDSAQI
EICVADWWGARENCGCIYRLRVRLLDVYENEVVKFSASPNPVLQWTERGCRQVSHVFTNF
GKGIRYVSFEQYGRDTRSWVGHYGTLVTHSSVRVRIRLS
Download sequence
Identical sequences F1N2I3
9913.ENSBTAP00000002336 ENSBTAP00000002336 XP_005218989.1.76553 XP_005218990.1.76553 XP_006068743.1.26621 XP_006068744.1.26621 XP_010813051.1.76553 ENSBTAP00000002336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]