SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002360 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000002360
Domain Number - Region: 280-373
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0361
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002360   Gene: ENSBTAG00000001804   Transcript: ENSBTAT00000002360
Sequence length 2354
Comment pep:known chromosome:UMD3.1:19:39626283:39641576:-1 gene:ENSBTAG00000001804 transcript:ENSBTAT00000002360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTRAVAMPSPAAGLLGCCFLFGWALGVPRTLRSLPALSSKIKPGSVPIWVPPEGAEAAL
AFLYSGDAQHLSGANCSERYEAPGAGARPGLPPVLWRAAGAVTQAANFLNMLLQANDIRE
SSVEEDVEWYQALVRSVAEGDPRAYRALLTFNPPPGASHLQLALQATRVGEETILQDLSG
NRVQEESSTGALHPADLQKRVLTNDLGSLGSPKWPQGDGYVGDVQHVRLSPPFLECQEGR
LRPGWLITLSATFYGLKPDLSPEVRGQVQMDVDLQSVDINQCASGPGWYSNTHLCDLNST
QCVPLESRGFVLGHYLCRCRPGFYGASNSLGSEEGAVQPPGQFGSPQGSSGRLLRCQPCA
EGCASCLDATPCLVEEAPRLRAAVLACQMCCMLVVFLSMLVSYRCRQSKRIRASGVVLLE
AILFGSLLLYFPVFILYFKPSVFRCIALRWVRLLGFAIVYGTIILKLYRVLQLFLSRTAQ
RGPHLSSGRLLRRLGLLLLLVLGFLAVWTAGVLEPGIQHTSLVTRGHTHTGRHFYLCHHD
RWDYIMVVAEMLLLCWGSFLCYATRAVPSAFHEPRYMGIALHNELLLSAAFHAARFVLVP
SLHPDWTLLLFFFHTHSTVTATLALIFIPKFRKPGAPPREEILDEVYEDELDLQRSGSYL
NSSITSAWSERSLDPGDIRDELKKLYAQLEVHKTKEMAANNPHLPKKRASWRQGLGRSFM
RYLAEFPEALARQHSRDSGSAGRGSLPGSSRRRLLSASLREPAAPPGLRKCRSTCEQDCD
PQRDHSPPLVDSLLRRKLARKGPRSDSRESGESAAGPPALGFRSASAHNLTVCERLPRAR
PASLHKSLSVVAGAREKALLVASQAYLEETYRQAKEREERRKAEAALASPARRPSARRLE
RVRAAPVSAPPSPAKSRSVDSSHVSGRLHEEAARRLPHVPIQHQISTPIMATSGAGLGEP
GMLSPTSTLAPALMPAPAPALAPIPVPPQSPNLLTYICPWENAELPVKKENVAQEGPSGP
EQGNPSHAPARARLWRALSVAVEKRGPGENGMDTEDGHLQGETEEDENRPKVFSKSHSLK
TPVQQGSMRSLGLAIKALTRSRSTHREKESGEGSPKKEKGRASGEGVGACPRSPRPGRPK
GVSKQAALGPYDDEESLQNQQNAHTSRMLQVCHRDSSREQEDRGRRTSQCLGEGKVERAG
KTGPATLKQLRQGTAGDKNAKQAKEAPVGWQELPKAGLQPLGSADPRVTEVCPWEVTESE
LCQPDGSNKAEICPWEVGGIPEEEALRQYLDASQGEKEKASEKSEPKDVVVVARKKPERL
VRGQEAVCPWESADPGGVSPGSAPQDSDRTRGRSEAVGSVEPREVETHRWEAPGPGACTS
DITTAELCPWEASEGETGKPSQEGVKKLPQEKQKTPEKTIFWKEQKLGEGLESLCQWERT
DFRGPSVVSTQAPGTPGCSGSLGSSITEVCPWEAGDSPAIGKAEICPWELGDEIVGKEML
SQGPGGESPQEKWDTSRTGSFGEMRGWTGKAVQKLSQQQESVCPWESTAAGHSGPHLDNS
SSKADGQLLSNKGSRAAQVCPPDLRSEGKGATPAKAEVCPWEVNERTTEDWTSGQAPKGR
ESQKDKEKMLEISGIKASPSWAKPEEQMPTQEAVCPWESVDPVSFTPQPGLQDTGGPKAS
FQMSGSVESKTAEICPWDAEETLPAEKAEVCPWEVSAGAGERRALGMEAIRQFSSKTRKP
SADSGPSERAVGTPERQAQERERACPWESMDPGGSSWHSDTLGTAKPKPGVQELDRVGCR
PVEVCPWEVEGAPTSEKVKVCPWEVDEGAPGKELEQEMRTDSVGQREKMLEKGRLTSLGE
DRSKWKTQLSQEQEAVCPWEKDLRAPTAQAPEVSDVSSRGVEEPSLEISDEAAEKGGLTQ
DPKMDSSPEHVAPEKAEVTAEDGEKVSSELQPVHLQESTAPRDSSSHPHSQCPDQPKACS
QTLPSAGDRLAEVCLWDASATDAPKPDGGAKAETCPWEVTERTPEEGASRQDGDEETQEE
KGKAPEKPEHKAVALQEEPERADGKQEPAPQASDSSKESPKAAGSVGARVAEVCPQEAQE
APPDKKTEICLWEVSQETAEKGGCEQEVDRESQGQRVMFLQKAESGGTEEHSSEEVKVSG
EMEAICPWEGTRSEGLSPQPDAPATDQPKDSPHGVSSMGSRVAELCQWEVTDPEGNKITG
TMADIDTCLWEGTGAPSEESGLLALTATQKQMLCPTAPENPPCLLVQRPLGSFFPDSKSP
RPKVNKPASTFTLEGVRELQVPSEPGPRTSLGPEPTLQEAMTQKSSSLTEDLEVASETQL
EELTPPTVYPWDWE
Download sequence
Identical sequences E1B9D3
ENSBTAP00000002360 ENSBTAP00000002360 9913.ENSBTAP00000002360 NP_001178173.1.59421 NP_001178173.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]