SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002365 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002365
Domain Number 1 Region: 10-164
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.35e-40
Family Dual specificity phosphatase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002365   Gene: ENSBTAG00000001809   Transcript: ENSBTAT00000002365
Sequence length 196
Comment pep:known_by_projection chromosome:UMD3.1:X:104278051:104278641:-1 gene:ENSBTAG00000001809 transcript:ENSBTAT00000002365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTPLCPFPIQAVRQPAAHGLSQITKSLYLSDAVAAKDKAMLSTNHITTVINVSMEATDT
FLEDIQYVKVPLADAPNSRLYDFFDFIADHIHSVEMKQGRTLLHCAAGVSRSATFCLAYL
MKYHSMSLLDAHTWTKSCRPTIRPNNGFWEQLIYYEFKLFSKNTVHMISSSMGMIPDVYE
KEICLMTLMGVIPDSS
Download sequence
Identical sequences L8ISI2 Q0II40
ENSBTAP00000002365 9913.ENSBTAP00000002365 NP_001071485.1.59421 NP_001071485.1.76553 XP_005891410.1.15283 XP_019811191.1.53367 ENSBTAP00000002365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]