SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002392 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002392
Domain Number 1 Region: 39-172
Classification Level Classification E-value
Superfamily L domain-like 1.26e-27
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002392   Gene: ENSBTAG00000001830   Transcript: ENSBTAT00000002392
Sequence length 324
Comment pep:known chromosome:UMD3.1:19:39241151:39245578:-1 gene:ENSBTAG00000001830 transcript:ENSBTAT00000002392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGAKLAQSPEEISGVCITEALITRRNLAFPEDEDLSEKMFHTLAELQTVRLDREGITTI
RNLEGLQNLHSLYLQGNKIQRIENLACVPSLRFLSLAGNQIRQVENLRDLPHLQFLDLSE
NLIETLKLDEFPESLLILNLTGNSCTNQDGYRKLLTEALPLLLDLDGQPVAERWTSDEED
TALSDEDEEFPELRGPFCSERGFLKELEQGMSRHRELRQQTALLEHQLRVETQPTLTDLP
PLPGAPMAGDSSPSVTPTQEKETTPEPASLPEASSTTKRLCPLAPRGQQSTMQARKGARA
ATAPKASLAGAPSTTKTVTKKIKK
Download sequence
Identical sequences Q2KIR9
9913.ENSBTAP00000002392 NP_001073267.1.59421 NP_001073267.1.76553 XP_019837116.1.53367 ENSBTAP00000002392 ENSBTAP00000002392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]