SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002402 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002402
Domain Number 1 Region: 7-138
Classification Level Classification E-value
Superfamily L domain-like 8.16e-22
Family U2A'-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002402   Gene: ENSBTAG00000001838   Transcript: ENSBTAT00000002402
Sequence length 754
Comment pep:known_by_projection chromosome:UMD3.1:18:35056134:35117221:1 gene:ENSBTAG00000001838 transcript:ENSBTAT00000002402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQWELDEEGIRRLGALTLEQPELVESLSLQGSYAGKIHSIGDAFRNFKSLRSLDLSRN
LITSLKGIQYLCSLQDLNLYYNNIPSLVEVSRLQPLPFLKELDLRLNPVVRKDTDYRLFA
VYMLQTLEKLDDRAVRESERKAAKLHFSQLGNSENFLLEVEKSSREKTVKNCVTNESTAS
KVSTDSDNRIETDSNKGLFIPFPNREIKDSLTSTSATQGSVIPDQKLDPFLLGTQMQEVA
RREMPSENNQEDEIRRYSPHQMTVRSPEKMAKEGYRISFLDNKSSGSSPEKDLIPKPDTY
QLTHDASLGKRLDVGDSSQIHPYQLPSDVGLENYDSHYSQNLSLHGSIGKRPQRNKNYRE
YSTKPSNNMKATTSHSCGDLLTSLSNPDSSTGRLLKLSSDLYAATHFNSDPALVVNVEQQ
LATSLSDLTQAHGSFPNNSILGDSLRTLLLPTGTSENRENLTKRSLSPSRRGFRRKENIL
ATLNTKHGFRDATGSEPLSSDLGSLHGLPGNHSPPVSARTSHVATVLRQLLELVDKHWNG
SGSLLLNKKFLGPARDLLLTLVVPAPSQQWCRSHPEDTSKAFHRREMELKETGQLVPNDM
EGLKQKLVRVLEENLILSEKVQRLEEGATTSIVSGHPSHTYDDLLRKNQQLNMQVSCLNQ
ELAQLKKLEETVTLLHESQRSLVVTNEYLLQQLNKEQKGYSGKALLPPEKSHHLGRSSPF
GKSTLSSSSPVAHDMGQYLIQTVSDSVPEPSLWS
Download sequence
Identical sequences E1B7U8
ENSBTAP00000002402 ENSBTAP00000002402 9913.ENSBTAP00000002402 NP_001179250.1.59421 NP_001179250.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]