SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002883 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002883
Domain Number 1 Region: 137-462
Classification Level Classification E-value
Superfamily L domain-like 2.3e-60
Family Ngr ectodomain-like 0.073
Further Details:      
 
Domain Number 2 Region: 603-701
Classification Level Classification E-value
Superfamily Immunoglobulin 1.92e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 690-785
Classification Level Classification E-value
Superfamily Immunoglobulin 9.05e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 498-608
Classification Level Classification E-value
Superfamily Immunoglobulin 6.23e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 5 Region: 58-160
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000147
Family Ngr ectodomain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002883   Gene: ENSBTAG00000002227   Transcript: ENSBTAT00000002883
Sequence length 1119
Comment pep:known chromosome:UMD3.1:5:54884677:54935650:1 gene:ENSBTAG00000002227 transcript:ENSBTAT00000002883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPRVRALAAALGLLLCEVLGHAGPAEGGGLEALGPPSGVGAEHQCPTPCRCFGDLLDC
SRQRLAHLPEPLPSWIARLDLSHNRLSFIKASSLSHLHSLREVKLNNNELETIPNLGPVT
ANITLLSLAGNKIVEILPEHLRQFQSLETLDLSGNNISELKTALPPLQLKYLYINSNRVT
SMEPGYFDNLASTLLVLKLNRNRISALPPKMFKLPQLQHLELNRNKIKNIDGLTFQGLGA
LKSLKMQRNGVTRLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAIS
RISPDAWEFCQKLSELDLTYNHLSRLDDSSFLGLSLLNTLHIGNNRVNYIADCAFRGLSS
LKTLDLKNNEISWTIEDMNGAFSGLDKLKRLILQGNRIRSITKKAFTGLDALEHLDLSDN
AIMSLQGNAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQSFVNASCAHPQLLKG
RSIFAVSPDGFVCDDFPKPQITVQPETQSAIKGSNLSFICSAASSSDSPMTFAWKKDNEL
LHDAEMENYAHLRAQGGEVMEYTTILRLRNVEFTSEGKYQCVISNHFGSSYSVKAKLTVN
MLPSFTKTPMDLTIRAGAMARLECAALGHPAPQIAWQKDGGTDFPAARERRMHVMPEDDV
FFIVDVKIEDIGVYSCTAQNSAGSISANATLTVLETPSFLRPLLDRTVTKGETAVLQCIA
GGSPPPRLNWTKDDSPLVVTERHFFAAGNQLLIIVDSDISDAGKYTCEMSNTLGTERGHV
RLSVIPTPTCDSPQMTASSLDDDGWATVGIVIIAVVCCVVGTSLVWVVIIYHTRRRNEDC
SITNTDETNLPADIPSYLSSQGTLADRQDGYISSENGSHHQFVTSSGGGFFLPQHDSNGT
CHIDNSSEADVEAATDPFLCPFLGPSGPVYLKGSVYGSDPFEAYHTGCGPDLRSALMDHY
EPSYIKKKECYPCPHPSEESCEQSVSDTGWPSHAKKLLSSSYSQHEGPGMNNLCLNKSSA
DFSPSPEPPSVTLSNSFMGTFGKPLRRPHLDAFSSSGQSSDCQPRAFHLKARSSPNLDYE
SEEDGKERTDFQQENHTCTHKQTLESHRTSNFQSFDLDT
Download sequence
Identical sequences E1BN69
ENSBTAP00000002883 NP_001192520.1.59421 NP_001192520.1.76553 XP_019816474.1.53367 ENSBTAP00000002883 9913.ENSBTAP00000002883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]