SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002944 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002944
Domain Number 1 Region: 1846-1973
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 947-1016
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.35e-18
Family TB module/8-cys domain 0.00068
Further Details:      
 
Domain Number 3 Region: 2331-2403
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-18
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 4 Region: 2050-2119
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.43e-17
Family TB module/8-cys domain 0.00000899
Further Details:      
 
Domain Number 5 Region: 448-576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 6 Region: 2445-2571
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.98e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 1530-1625
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.62e-17
Family TB module/8-cys domain 0.0000103
Further Details:      
 
Domain Number 8 Region: 534-654
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.16e-17
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 9 Region: 1022-1166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 10 Region: 2129-2258
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 11 Region: 652-725
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.83e-16
Family TB module/8-cys domain 0.00082
Further Details:      
 
Domain Number 12 Region: 1151-1280
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.53e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 13 Region: 1316-1450
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.13e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 14 Region: 179-264
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.69e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 15 Region: 325-391
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.8e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 16 Region: 1684-1750
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.11e-16
Family TB module/8-cys domain 0.00094
Further Details:      
 
Domain Number 17 Region: 844-928
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000392
Family TB module/8-cys domain 0.0022
Further Details:      
 
Domain Number 18 Region: 2571-2687
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000612
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 19 Region: 763-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000113
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 20 Region: 723-776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000518
Family EGF-type module 0.008
Further Details:      
 
Domain Number 21 Region: 1604-1653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000276
Family EGF-type module 0.00042
Further Details:      
 
Domain Number 22 Region: 1765-1814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 23 Region: 2007-2055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000518
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 24 Region: 284-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000121
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 25 Region: 1966-2010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000132
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 26 Region: 1481-1528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000234
Family EGF-type module 0.00018
Further Details:      
 
Domain Number 27 Region: 1444-1492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000302
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 28 Region: 2221-2339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000408
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 29 Region: 2406-2450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000543
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 30 Region: 1808-1844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000345
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 31 Region: 1274-1320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000531
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 32 Region: 1646-1689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000341
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 33 Region: 803-846
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000444
Family EGF-type module 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002944   Gene: ENSBTAG00000002278   Transcript: ENSBTAT00000002944
Sequence length 2871
Comment pep:known chromosome:UMD3.1:10:61877808:62142171:1 gene:ENSBTAG00000002278 transcript:ENSBTAT00000002944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGGLLEVALGFTVLLASYTSHGADTNLEAGNVKETRANRAKRRGGGGHDALKGPNVCG
SRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQHCN
IRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERD
YRTGPCFTVISNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIR
TGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGICD
GGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALANGRCSNQLPQSITKMQCCC
DVGRCWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPERPGYPPPPLGPVPPVQPVPPGFP
PGPQIMIPRPPVEYPYPSREPPRVLPVNVTDYCQLFRYLCQNGRCIPTPGSYRCECNKGF
QLDLRGECIDVDECEKNPCAGGECINTQGSYTCQCRPGYQSTLTRTECRDIDECLQNGRI
CNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKP
GFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRST
CYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPSQNSAEYQALCSSGPGITSA
GSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQ
CRNTPGSFVCTCPKGFIYKPELKTCEDIDECESSPCINGVCKNSPGSFICECSSESTLDP
TKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTPCQVDPICGKGY
SRIKGTQCEDIDECEVFPGVCKNGLCVNSKGSFKCQCPSGMTLDATGRICLDIRLETCFL
RYEDEECTLPVAGRHRMDACCCSVGAAWGTEECEECPVRNTPEYEELCPRGPGFATKEIT
NGKRFFKDINECKMIPNLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDL
CGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCLNTEGSYRCEC
PPGHQLAPNISACIDINECELSAHLCPHGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDE
CSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGE
YRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGC
TDINECEIGAHNCDRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADC
KNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSAD
GKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISG
NCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKA
SCCCSLGKAWGTPCELCPPVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGG
KCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQ
VNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPS
TDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYN
DKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNIC
SHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGF
ILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLD
PRKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLC
PDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCP
TEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILQ
GNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFR
CVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYLCICGPGY
QRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCF
TEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNG
ADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICK
NTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGSFTCKCPPGFTQHHT
ACIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDPSGASCEDVDECEGNHRCQHG
CQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQYE
QFSGGCQDINECGSAQAPCSYGCSNTEGGYLCACPPGYFRIGQGHCVSGMGMGRGNPEPP
ASGEMDDNSLSPEACYECKINGYPKRGRKRRSANETDASNIEDQPEIEANVSLASWDVEK
TAVFAFNISHISNKVRILELLPALTTLTNHNRYLIESGNENGFFKINQKEGISYLHFTKK
KPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQILLH
Download sequence
Identical sequences P98133
XP_015328665.1.76553 ENSBTAP00000002944 ENSBTAP00000002944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]