SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002970 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002970
Domain Number 1 Region: 618-859
Classification Level Classification E-value
Superfamily HCP-like 5.32e-30
Family HCP-like 0.0011
Further Details:      
 
Domain Number 2 Region: 831-946
Classification Level Classification E-value
Superfamily HCP-like 0.000000000628
Family HCP-like 0.01
Further Details:      
 
Domain Number 3 Region: 231-376
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000327
Family Laminin G-like module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002970   Gene: ENSBTAG00000002299   Transcript: ENSBTAT00000002970
Sequence length 1078
Comment pep:known chromosome:UMD3.1:6:46791165:46881531:-1 gene:ENSBTAG00000002299 transcript:ENSBTAT00000002970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFVPSLGRQTSLTTSVIPRAEQSVAYKDFIYFTIFEGNVRNVSEVSVEYLCSQPCVVNLE
AVVSSEFRSSIPVYKKRWKNEKHLHTSRTQIVHVKFPSIMVYRDDYFIRHSISVSVVILR
AWITHQYSSGDLNVKWEENLLHAVAKNYTLLKTVPPFERPFKDHQVCLEWNMDYIWNLRA
NKIPQCPLENDVVTLLEFLYASSGENTGIVKKFLRFQNRELEATRRQRIDYPVFTVSLWL
YLLHYCKANLCGILYFVDSNEMYGTPSIFLTEEGYLHIQMHLVKGEDLAVKTKFTIPLKE
WFRLDISFNGGQIVVTTSTGQDLKDYHNQTISFREDFHYNDTSGYFIIGGSRYVAGIEGF
FGPLKYYRLHALHPAQIFNPLLEKQLSQQIKFYYERCAEVQEIVSVYTSTAQQGDRRQEA
CNLRNSYLDLKLRYGRPSMCRAFPWEKELRAKHRSLFQALLELSLVTVPRNQNESVLDIG
GRIFEKAVKRLSSVDGLHQISSIVPFLMDASCCGYHKASYYLAVFYETGLTVPRDQLQGM
LYSLVGGQGSERLSSMNLGYKHYQGIDNYPLDWELSYAYYSNIATKTPLDQHTLQGDQAY
VETIRLKDDEILKVQTKEDGDVFMWLKHEATRGNAAAQQRLAQMLFWGQQGVTKNPEAAI
EWYAKGALETEDPALIYDYAIVLFKGQGVKKNRRLALELMKKAASKGLHQAVNGLGWYYH
KFKKNYAKAAKYWLKAEEMGNPDASYNLGVLYLDGIFPGVPGRNQTLAGEYFHKAAQGGH
IEGTLWCSLYYITGNLETFPRDPEKAVVWAKHIAEKNGYLGHVIRKGLNAYLEGSWHEAL
LYYVLAAETGIEVSQTNLAHICEERPDLAKRYLGVNCVWRYYNFSVFQIDAPSFAYLKMG
DLYYYGHQNQSQDLELSVQMYAQAALDGDSQGFFNLALLIEEGAMIPHHILDFLEIDPTI
HSNNISILRELYERCWSHSNEESFSPCSLAWLYLNLRLIWGAVLHSALIYFLGTFLLSIL
IAWTVQYFQSVSASSSHLMPARVSENPTDPTASPAVTPTADASAQDQPTITNNPEPRG
Download sequence
Identical sequences F1N168
ENSBTAP00000002970 ENSBTAP00000002970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]