SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003229 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003229
Domain Number 1 Region: 1619-1761
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-51
Family Phosphotyrosine-binding domain (PTB) 0.000000466
Further Details:      
 
Domain Number 2 Region: 228-355
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.19e-40
Family PLC-like (P variant) 0.0028
Further Details:      
 
Domain Number 3 Region: 62-226
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.06e-31
Family Dual specificity phosphatase-like 0.00011
Further Details:      
 
Domain Number 4 Region: 1467-1609
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-22
Family SH2 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003229   Gene: ENSBTAG00000002485   Transcript: ENSBTAT00000003229
Sequence length 1767
Comment pep:known chromosome:UMD3.1:2:106627006:106773157:-1 gene:ENSBTAG00000002485 transcript:ENSBTAT00000003229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVNTETAPKNVVDTGEAASRGGNTRKSLEEDSSTRVTPSVQPHPQPIRNMSTSRTTEDSC
ELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLH
AKVLEFGWPDLHTPALEKICSVCKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYMHYS
NISASADQALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIM
HGIPNFESKGGCRPFLRIYQAMQPVYTSGIYNVQGDSQTSICITIEPGLLLKGDILLKCY
HKKFRSPTRDVIFRVQFHTCAIHDLGVVFGKEDLDDAFRDDRFPEYGKVEFVFSYGPEKI
QGMEHLENGPSVSVDYNTSDPLIRWDSYDNFNGHRDDGMEEVVGHTQGPLDGSLYAKVKK
KDSLHGSTGAVNATRPVLSATPNHVEHTLSVSSDSGNSTASTKTDKTDEPAPGPASAPAA
LSPEEKRELDRLLSGFGLEREKQGAMYHPQHLRSRPVGGPAAPSSGRHIVPAQVHVNGGA
LASERETDILDDELPNQDGHSVGSMGTLSSLDGVTNTSEGGYPEALSPLTNGLDKPYPME
PMVNGGGYPYESASRAVSAQAGHTAPMRPSYSTQEGLAGYQREGPHPAWPQSATTSHYGH
DPNGMFRSQSFPETEPQLPPAPARGGSSREAVQRGLNSWQQQQQQQQQQQQPRPPPRQQE
RVHLESLGLSRPSPQPLAEPPMSGLPEFPRAASQQEIEQSIEALNMLMLDLEPATAGAPL
HKSQSVPGAWPGASPLSSQPFSGSSCQSHPLTQSRSGYIPSGHSLGTPEPAPRAPLESVP
TGRPYSPYDYQPCPTGPNQSYHPKSPATSSSSSFLPTTQSSVGPQQPPASLPGLTTQPQL
PPKEVTSDPSRTPEEEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRKRAASDGQYENQSP
EPTSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYKEAFEEMEGTSPTSPPPSG
GAVRSPPGLAKTPLSALGLKPHNPADILLHPTGEPRSYVESVVRTAVAGPRTQEPEPKSF
SAPGAQAYGHETPLRIGTLGGSFVSPSPLSTSSPILSADSTSVGSFPSGESSDQGARTPT
QPLLDSGFRSGSLGQPSPLAQRNYQSSSPLPTAGSSYSSPDYSLQQFSSPEGQARSQFSV
AGVHTVPGSPQARHRTVGTNTPPSPGFGRRAVNPSLAAPSSPSLSHRQVMGPLGTGFHGN
TGSSPQSSAATTPGSPSLGRHPGAHQVSNLHGNVVTAPGSPSLGRHPGAHQGTLASNLHS
NAVASPGSPSLGRHLGGSGSVVPGSPSLDRHVPYGGYSTPEDRRPTLSRQSSASGYQAPS
TPSFPVSPAYYPGLSSPATSPSPDSAAFRQGSPTPALPEKRRMSMGDRAGSLPNYATVNG
KVSSSPVASGMSSPSGGSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEI
SREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFL
IETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANS
TSDLLKQGAACNVLFVNSVDMESLTGPQAISKAISETLAADPTPAATIVHFKVSAQGITL
TDNQRKLFFRRHYPLNTVTFCDLDPQERKWTKTEGGAPAKLFGFVARKQGSATDNACHLF
AELDPNQPASAIVSFVSKVMLSAGQKR
Download sequence
Identical sequences E1BNT5
ENSBTAP00000003229 ENSBTAP00000003229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]