SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003249 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003249
Domain Number 1 Region: 77-265
Classification Level Classification E-value
Superfamily RNI-like 1.84e-33
Family Cyclin A/CDK2-associated p19, Skp2 0.01
Further Details:      
 
Domain Number 2 Region: 18-56
Classification Level Classification E-value
Superfamily F-box domain 0.0000131
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003249   Gene: ENSBTAG00000002500   Transcript: ENSBTAT00000003249
Sequence length 300
Comment pep:known chromosome:UMD3.1:26:22917659:22919707:1 gene:ENSBTAG00000002500 transcript:ENSBTAT00000003249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPMDPSGGEQEPGAVRLLDLPWEDVLLPHVLSRVPLRQLLWLQRVSRAFRALVQLHLA
RLRRFDAAQVGPQIPRAALAWLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVA
LAGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLK
DEAIVYLAQRRGAGLRNLSLAVNANVGDTAVQELARNCPELQHLDLTGCLRVGSDGIRTL
AEYCPALRSLRVRHCHHVAEPSLSRLRKRGVDIDVEPPLHQALVLLQDMVGFAPFVNLQV
Download sequence
Identical sequences E1BNS0
ENSBTAP00000003249 ENSBTAP00000003249 9913.ENSBTAP00000003249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]