SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003252 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003252
Domain Number 1 Region: 215-710
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 1.7e-153
Family Aconitase iron-sulfur domain 0.0000000000197
Further Details:      
 
Domain Number 2 Region: 714-967
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 2.94e-72
Family LeuD-like 0.0000000156
Further Details:      
 
Domain Number 3 Region: 19-145
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 3.73e-25
Family Aconitase iron-sulfur domain 0.00000638
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003252   Gene: ENSBTAG00000002504   Transcript: ENSBTAT00000003252
Sequence length 969
Comment pep:known_by_projection chromosome:UMD3.1:21:31352398:31401775:1 gene:ENSBTAG00000002504 transcript:ENSBTAT00000003252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPSAGYAFEYLIETLNDSSHKKFFNVPRLGGTKYESDVLPYSIRVLLEAAVRNCDGFL
MKKEDVMNILDWKTKQSNVEVPFFPARVLLQDFTGIPAMVDFAAMREAVKTLGGDPKKVH
PACPTDLTVDHSLQIDFNKWNDSAIQNAPNPGGGDLQKAGKLSPLRVQPKKLPCRGQTTC
RGSCDSGELGRNSGKFSSQIENTPILCPFHLQPVPEPETVLKNQEVEFGRNRERLQFFKW
SSRVFKNVAVIPPGTGMAHQVNLEYLSRVVFEEKDLLFPDSVVGTDSHITMVNGLGILGW
VGVGGIETEAVMLGLPVSLTLPEVVGCELTGSSNPFVTSIDVVLGITKHLRQVGVAGKFV
EFFGSGVSQLSIVDRTTIANMCPEYGAILSFFPVDNVTLKHLEHTGFDKAKLESMEAYLK
AVKLFRNEQDNLGEPEYSQEIRASVKTVLPLSGEKHLRNKIFYCNFFIFFLFFLVENVGF
KGFQIAAEKQNDIVSIHYEGSDYKLAHGSVVIAAVISCTNNCNPSVMLAAGLLAKKAVEA
GLQVKPYIRTSLSPGSGMVTHYLSSSGVLPYLSKLGFEIIGYGCSTCVGNTAPLSEAVLN
AVKQGDLVTCGVLSGNKNFEGRLCDCVRANYLASPPLVVAYAIAGTVNIDFQTEPLGTDP
TGKNIYLHDIWPSREEVHQIEEEHVVLSMFKALKEKIEMGNKRWNSLEAPDSVLFPWDLK
STYIRCPSFFDKLTKEPVALQPIENAHVLLYLGDSITTDHISPAGSIARSSAAAKYLTNR
GLTPREFNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTLDVFEAAELY
QKEGIPLIILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLQFL
PGESADSLGLSGRETFSLTFPEELSPGVTLNIKTSTGKVFSVIASFENDVEITLYKHGGL
LNFVARKFS
Download sequence
Identical sequences E1BNR2
9913.ENSBTAP00000003252 ENSBTAP00000003252 ENSBTAP00000003252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]