SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003261 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003261
Domain Number 1 Region: 225-422
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.06e-28
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 454-604
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000138
Family Nucleotide and nucleoside kinases 0.031
Further Details:      
 
Domain Number 3 Region: 2-39
Classification Level Classification E-value
Superfamily SAP domain 0.0000000641
Family SAP domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003261   Gene: ENSBTAG00000002510   Transcript: ENSBTAT00000003261
Sequence length 749
Comment pep:known chromosome:UMD3.1:29:41730792:41739870:-1 gene:ENSBTAG00000002510 transcript:ENSBTAT00000003261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVKRLKVTELRSELQRRGLDSRGLKVDLAQRLQEALDAEMLEDEAGGGGAGPGGACKAE
PRPVAASGGGPGGDEEEDEEEEEEDEEALLEDEDEEPPPAQASGQAAQPPPEPPEAAAVE
AEAEPDASEKAAEEATAESGGVNGGEEQGTGKGEEDEPEERSGDETPGSEAPGDKAAEEQ
GDDQDSEKSKPAGSDGERRGVKRQRDEKDEHGRAYYEFREEAYHSRSKSPPPPEEEVKDE
EEDHTLVNLDTYTSDLHFQVSKDRYGGQPLFSEKFPTLWSGARSTYGVTKGKVCFEAKVT
QNLPMKEGCTEVSLLRVGWSVDFSHPQLGEDEFSYGFDGRGLKAENGQFEEFGQTFGEND
VIGCFANFEAEEVELSFSKNGEDLGVAFRISKESLADRALLPHVLCKNCVVELNFGQKEE
PFFPPPEEFVFIHAVPVEERVRTAVPPKTIEECEVILMVGLPASGKTQWALKYAKENPEK
RYNVLGAETVLNQMRMKGLEEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRNFILDQCN
VYNSGQRRKLLLFKTFSRKVVVVVPNEEDWKKRLELRKEVEGDDVPESIMLEMKANFSLP
EKCDYMDEVTYGELEKEEAQPIVTKYKEEARKLLPPSEKRTNRRNNRNKRNRQNRSRGQG
YVGGQRRGYDNRAYGQQCWGQSGNRGGYRNFYDRYRGDYDRFYGRDYEYNRYRDYYRHQY
TRDWQNYYYHHPQDRDRYYRNYYGYQGYR
Download sequence
Identical sequences E1BNQ9
9913.ENSBTAP00000003261 ENSBTAP00000003261 NP_001193174.1.59421 NP_001193174.1.76553 ENSBTAP00000003261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]