SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003367 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003367
Domain Number 1 Region: 742-937
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.71e-46
Family WD40-repeat 0.0000699
Further Details:      
 
Domain Number 2 Region: 130-191
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000183
Family B-box zinc-binding domain 0.0011
Further Details:      
 
Domain Number 3 Region: 377-436
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000273
Family SPRY domain 0.0064
Further Details:      
 
Domain Number 4 Region: 599-721
Classification Level Classification E-value
Superfamily F-box domain 0.000000000249
Family F-box domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003367   Gene: ENSBTAG00000002605   Transcript: ENSBTAT00000003367
Sequence length 939
Comment pep:known chromosome:UMD3.1:19:33601282:33650183:-1 gene:ENSBTAG00000002605 transcript:ENSBTAT00000003367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGRGSPAPQWQTVYMAELDLMAPGPLCGVPAHPPAALSPDSGSASPAEEENPGSPGSPPG
ETGETGGQGSEWQGAPKAEGLEEEEEVLCDFCLGASRVRAVKSCLTCMVNYCPEHLRPHQ
ENSRLHGHQLTEPARDRDLRVCPAHRSPLIAYCDPDGQCICEECSQAEHRGHALVSLDAA
RRAKEAELRRTQLDLERKLKLNENAISRLQANHKSVLVSVSEVKAGVEEQFGELRAALTK
AQADVMLFLEEKEQAALGQANGIKTHLEYRSAEMEKARQELDRIAAIGSPVLFLEEYCKF
KNTEDGAFPSVYIGLKDKLSGIHKVIMDSTALLIQLLQSYKEKLQEFSKDEEYDIRTQVC
AVIEHRHRTSEPEPCSRQQLLQYACDIVFDPDTAHRYLRLQDDNRKVTNTAPWEHPYPDL
PSRFSHWRQVLAQQSLYLHRNRVRMRRRVSGCCPGLLTVLVPLFAPQWLFVPTSDGPCSS
PQIKTGMKGLNKAGIGVLHYPEKGHTHSCDTSQVCWAARTRHTTFPLSKATASMHMLTGE
VRNKDEKVQWKSSLQCISEMNRLFSEKASVSKSGLAPATDVLLELDTVRELSSGVSRYRD
FIRQLPIHLSKYILSLLDRSTLNRCSFVSQHWAALAQQVKADLSMHSFIQHQITFLQGSY
TRGIDPNYANKVIIPIPKMTDDGKRLRVKNQKWKLRTKNDYNLWTAYQNQETQQVQMEER
NVFCGSYNIRILSDTWDRNRIIHYSGGDLLAVSSNRKIQLLDIIRVKEIPIRFRGHAGSV
RALFLCEEENFLLSGSYDLSIRYWDLKSGACIRIFNGHQGTITCMDVYKNKLASGAKDCQ
VKEWDIETGKCLKTFKHKDPILDTRINDTYIVSSCEKGMVKVWHMVTAQLVKTLNGHEGA
VKCLYFDQWHLLSGSTDGLVMAWSMVGKYERCLMAFKHP
Download sequence
Identical sequences F1MLX8
ENSBTAP00000003367 ENSBTAP00000003367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]