SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003370 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003370
Domain Number 1 Region: 115-399
Classification Level Classification E-value
Superfamily L domain-like 7.37e-63
Family Ngr ectodomain-like 0.002
Further Details:      
 
Domain Number 2 Region: 318-557
Classification Level Classification E-value
Superfamily L domain-like 7.48e-37
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 3 Region: 619-909
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.28e-34
Family Rhodopsin-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003370   Gene: ENSBTAG00000002606   Transcript: ENSBTAT00000003370
Sequence length 1034
Comment pep:known chromosome:UMD3.1:15:58873843:58977292:-1 gene:ENSBTAG00000002606 transcript:ENSBTAT00000003370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PREDLGLPLRFHGAAGRAKLRSAAFLRCCRGLLKEPSPRAERGEPPAQPAGLPPRAAGGV
GGRRRRAERAAPRERPARVAAAAMPGPLGLLCFLALGLRGSAEPSGAAPPLCAAPCSCDG
DRRVDCSGKGLTAVPEGLSAFTQLLDISMNNITQLPEDAFKNFPFLEELRLAGNDLSFIH
PKALSGLKELKVLTLQNNQLKTVPSEAIRGLSSLQSLRLDANHITSVPEDSFEGLTQLRH
LWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIKSLG
QHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELLFHSNSISVIPDGAFDGNPLLKTI
HLYDNPLSFVGNSAFHNLSELHSLVIRGASMVQRFPNLTGTVRLESLTLTGTKISSISNN
LCQEQKRLRTLDLSYNSIKDLPSFNGCHALEEISLQRNQIHQIKEDTFQGLTSLKILDLS
RNLIHEIDDRAFAKLGSITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFV
NLRSLSVPYAYQCCAFWGCDSYTHSNTEDNSLQDHSGSKDKGLSDVAGVTSSAENEEHSQ
IIIHCTPSTGAFKPCEYLLGSWMIRLTVWFIFLVALFFNLLVILTTFASCTSVPSSKLFI
GLISVSNLFMGAYTGILTFLDAVSWGRFAEFGIWWEIGSGCKIAGFLAVFSSESAIFLLM
LAAVERSLSAKDMMKNGKSNHLRQFRIAALLAFLGAAVAGSFPLFHRGEYSASPLCLPFP
TGETPSLGFTVTLVLLNSLAFLLMAIIYTKLYCNLEKEDLSESSQSSMIKHVAWLIFTNC
IFFCPVAFFSFAPLITAVSISPEIMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKR
HVSKKSGSASVSISSQAGCVEQDFYYDCGMYSHLQGNLTVCDCCEAFLLTKPVSCKHLIK
SHSCPALTVGSCQRPDGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGF
PLVRYAYNLPRVKD
Download sequence
Identical sequences A0A0A0MP87
ENSBTAP00000003370 ENSBTAP00000003370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]