SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003445 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003445
Domain Number 1 Region: 42-231
Classification Level Classification E-value
Superfamily L domain-like 1.9e-40
Family Ngr ectodomain-like 0.008
Further Details:      
 
Domain Number 2 Region: 253-292,320-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000308
Family I set domains 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003445   Gene: ENSBTAG00000002661   Transcript: ENSBTAT00000003445
Sequence length 750
Comment pep:known_by_projection chromosome:UMD3.1:21:34950166:34952418:-1 gene:ENSBTAG00000002661 transcript:ENSBTAT00000003445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLRALCLAWALLGAATACPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSA
NKITVLRRGAFADVTQVTSLWLAHNEVRTVEPGSLAVLSQLKNLDLSHNLISSFPWSDLR
NLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYH
NPFHCSCSLVWLQAWAASTRVSLPEPDSIACASPPELQGVPVHRLPALSCVPPSVHLSME
PPPEAPGSPLPSGLTLMVHCVAEGHPTPRLQWQLQIPGGTVVLAPQVLSGEDGGNGAEDG
EGEGDGDGPTQTEAPTLTPAHAWPAPPATQRFLALTNGSLLVPFLSAKEAGVYTCRAHNE
LGANSTSVRVAVAAAGPPKHAPGAGGDPDGQAPTSERKSTAKTRGNSVLTSKPEGKIKGQ
GVGRVSVLGDSEMGPEQEEAEEEAGEGEEAENQVPADPVEEQRCGQGDLSRYVSNHAFNQ
SAELKPHVFELGVIALDVAEREARVQLTPLAARWGPGPGGASGGGRPERRPLRLLYLCPA
GGGAAVQWSRVEEGVNAYWFRGLRPGTNYSVCLALAGEACHVQVVFATKKELPSLLVIVA
VSVFLLVLATVPLLGAACCHLLAKHPGKPYRLILRPQAPDPMEKRIAADFDPRASYLESE
KSYPAGGEAGGEEPEEAPGEGLDEDAEQGDPSGDLQREESLAACSLVESQSKANQEEFEA
GSEYSDRLPLGAEAVDIAQEINGNYRQTVG
Download sequence
Identical sequences F1N7G4
ENSBTAP00000003445 ENSBTAP00000003445 XP_002696730.1.76553 XP_005192950.1.59421 XP_005192956.1.59421 XP_005222077.1.76553 XP_005222083.1.76553 XP_010796918.1.59421 XP_010815443.1.76553 XP_874788.3.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]