SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003600 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003600
Domain Number 1 Region: 1246-1543
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.9e-71
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003600   Gene: ENSBTAG00000002774   Transcript: ENSBTAT00000003600
Sequence length 1721
Comment pep:known_by_projection chromosome:UMD3.1:22:52818988:52844833:-1 gene:ENSBTAG00000002774 transcript:ENSBTAT00000003600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAWLSLQLRKLGERPGGRRVPAAMEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGEN
PEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVSVTWT
EIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFSYL
REHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEA
CRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGEQVAYFQSAL
DKLNEAIKLAKGQPDTVQDALRFAMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAP
LVKPLPVNPTDPAVTGPDIFAKLVPMAAHEASSLYSEEKAKLLREMMAKIEDKNEVLDQF
MDSLQLDPETVDNLDAYNHIPPQLMEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLK
DVRDLLEEDEALEQKLQEAVGPAAASTATSKAELAEVRREWAKYMEVHEKASFTNSELHR
AMNLHVGNLRLLSGPLDQVRAALPSPALSAEDKAVLQNLKRILAKVQEMRDQRVSLEQQL
RELIQKDDITAVLVTADHSEMKKLFEEQLKKYDQLRVYLEQNLAAQDNVLRALTEANVQY
AAVRRVLGDLDQKWNSTLQSLVASYEAYEDLMKKSQEGKDFYADLESKVAALLERTQSAC
QAREATRQQLLDRELKKKPPPRPTAPKPLLPRREEGEAMEAGDLPEELRSLPPEPFLGAA
APLHFPPGPFPSSAGPGPHYLSGALPPGTYAGPTHMLQPRAPQPPGHPGVAVAPGPALYT
APAYAPELGLVPRSSPQHGMVSSPYGGVGPPPPLAGLPSAPPPHFSGHELVVGVRPATTT
VDSVQAPISSHTAPRPNPAPAPPQACFPGPPPQPLPLPYTYPMGPKQPLTLREILTPSSG
IILPVPRNTYHQVTSARGGGMPGTQREVPEGWPRQADPLGHLQAALSQVCQHPQSRPVPH
GPHILPSRSRGPQSCKVLPPARGVPQDADVKESPLFSHQRLQHPHVFPPQAPGLVPAQAS
YPFAPQPGVLGQPSPALHTQLYPGPSQDPPPPHSGALPFASAGPPQPPHPTLAYGPAPAP
RPLGPQAAPLSIRGPPPAIQPAPTPHLVPSPAPSPGPGPVPPRPPAAEPPPCLRRGTAAA
DLLSSSPESQHGGPQPPGGGQPLLQPTKVDAAEGRRPQALRLIERDPYERPERLQQLRQE
LETFRGQLGAAGALDTVWRELQDAQELDARGRSIAIARCYSLKNRHQDVMPYDSNRVVLR
SGKDDYINASRVEGLSPYCPPLVATQAPLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKQ
KVARYFPTERGQPMVHGALSLALSSVRTTETHVERVLSLQFRDQSLKRSLVHLHFPTWPE
LGLPDSPSHLLRFIQEVHAHCLHQRPLHTPVVVHCSRSSGVGRTGAFALLYAAVQEVEAG
SGIPQLPQLVRRMRQQRKHMLQEKLHLKFCHEAVVRHVEQVLQRHGVPPPSKPTAGTGIT
QKNHLPQDSQDLVLGGDVPISSIQATIAKLSIRPPGGMDSPVASLPGPVEPPSLPPPSLP
ESTQLPSSSPPPPSSPLPEAPQPEEEQPVPEAPSLGPPSSSLELLASLTPEAFSLDGSLR
GKQRMSKQDFLQAHNGQGLRAARPTDDPLSLLDPLWTLNKT
Download sequence
Identical sequences E1BIU7
ENSBTAP00000003600 ENSBTAP00000003600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]