SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003821 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003821
Domain Number 1 Region: 60-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000512
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000003821
Domain Number - Region: 7-113
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00196
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003821   Gene: ENSBTAG00000002937   Transcript: ENSBTAT00000003821
Sequence length 641
Comment pep:novel chromosome:UMD3.1:7:12206055:12266930:1 gene:ENSBTAG00000002937 transcript:ENSBTAT00000003821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLCFLLSLSGVVAQKTKGTCTHCPQNAFCVNATHCTCNHGYRSESKEKYFSYRFERCED
VDECKPPISVYCGVNAECQNIIGSFYCHCIDGYKLLSGKAQFNNSNENTCQKITPSKTTN
STKEMQQVVEDIESHLTGKTVLGVERNFTSTVTAFLQKVESDVLKTALKAPDQKIQKVQY
STVAVETQVVTDNCSKRVILSLNAQVNSMKIHCSDVIQRNIKGTSAVAFVSYSSLGNIIN
AFFEEMNEKDQVYLNSQVVSAAIEPKKNTSLSQPVILNFQHMKVKPGVKKIFCVYWKDTK
EGGRWSKDGCALRQANKTHTICSSTHLSSFAVLMALHGQEEDPALTVITYVGLSLSLLCL
LLAALTFLLCKAIQNTSTSLHLQLSLCLFLAHLLFLTAIDRTENKVLCAIIAGALHYLYL
ASFTWMLLEGLHLFLTARNLTVVNYSSINRLMKWLMFPVGYGVPAVIVAISAASRPHLYG
TPDRCWLHLDQKFIWAFLGPVCAIICVNFVFFVMVFWILKRKLSSLNSEVSTIRNVKMLT
LKATAQLFILGCTWFLGLLQVGPAARVMAYLFTIINSLQGVFIFLVYCLLSQQVMFQVQK
WFGEIIKSKSESEAYTLSSRFGADSKPSEGETYNHRHSRVV
Download sequence
Identical sequences G5E538
ENSBTAP00000003821 ENSBTAP00000003821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]