SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003856 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003856
Domain Number 1 Region: 1-201
Classification Level Classification E-value
Superfamily L domain-like 1.5e-36
Family Ngr ectodomain-like 0.059
Further Details:      
 
Domain Number 2 Region: 475-585
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.05e-26
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003856   Gene: ENSBTAG00000002959   Transcript: ENSBTAT00000003856
Sequence length 625
Comment pep:known_by_projection chromosome:UMD3.1:12:16540818:16744403:1 gene:ENSBTAG00000002959 transcript:ENSBTAT00000003856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSKNRLVEVPMELCHFVSLEILNLYHNCIRVIPEAIINLQMLTYLNLSRNQLSALPACLC
GLPLKVLIASNNKLGSLPEEIGQLKQLMELDVSCNEITALPQQIGQLKSLRELNVRRNYL
KVLPQELVDLPLVKFDFSCNKVLVIPICFREMKQLQVLLLENNPLQSPPAQICTKGKVHI
FKYLSIQACQIKTTDSLYLHTMERPHLHQQVEDGKKDSDSGVGSDNGDKRLSATEPSDED
AVSLNVPMSNIMEEEQMKEDSCHRLSPVQGGFHQEFQPAPSLVSDSDNSGEDRGQFSHGK
DVIHSEFINYMKEKTEACEELLRIEEDAHWPSEGTISASKDQDLDIAMIEQLREAVDLLQ
DPSRLSTDITERSVVNFYPVDPADDLELQDSTLNGQIQLERSPECEAQNDLTLQSNGSEY
SPNEMRENSPASSPTNTSTALFGLKPRSVFLRPQRNLESIDPQFTIRRKMEQMREEKELV
EQLRESIEMRLKVSLHEDLGAALMDGVVLCHLVNHIRPRSVASIHVPSPAVPKLSMAKCR
RNVENFLEACRKLGVPEADLCSPYDILQLDFRHIRKTVDTLLALGEKPPQPTSALRSRDL
ISFCLVHILFIVLIYITYRWNALPP
Download sequence
Identical sequences F1MDS5
ENSBTAP00000003856 ENSBTAP00000003856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]