SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003871 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003871
Domain Number 1 Region: 21-229
Classification Level Classification E-value
Superfamily PHP domain-like 3.65e-45
Family RNase P subunit p30 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003871   Gene: ENSBTAG00000002973   Transcript: ENSBTAT00000003871
Sequence length 268
Comment pep:known_by_projection chromosome:UMD3.1:26:12531280:12559200:1 gene:ENSBTAG00000002973 transcript:ENSBTAT00000003871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFADLDLRAGSDLKALRGLVENAAHLGYSVVAINHVVEFKEKKQEIEKPVAVSELFTT
LPIVQGKSKPIKILTRLTIIVSDPSHCNVLRATSSRVRLYDIVAVFPKTEKLFHVACTHL
DVDLVCITVTEKLPFYFKRPPINVAIDRGVGFELLYSPAIKDSTMRRYTISNALNLMQVC
KGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAALSTNCRAVLLHGETRKTAFG
IISTVKKPRTSEADDDSLPACKKAKCES
Download sequence
Identical sequences F1MDQ8
ENSBTAP00000003871 ENSBTAP00000003871 9913.ENSBTAP00000003871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]