SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003923 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003923
Domain Number 1 Region: 69-330
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.93e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003923   Gene: ENSBTAG00000003016   Transcript: ENSBTAT00000003923
Sequence length 339
Comment pep:known chromosome:UMD3.1:16:70902206:70917245:-1 gene:ENSBTAG00000003016 transcript:ENSBTAT00000003923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQPPPDQAPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVRTPQEVTLHFLRTAGRP
LSRQALQHRPPSPTQLEEEFLRIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRA
QSQEDGDYINANYIRGYDGQDKAYIATQGPMPNTVSDFWEMVWQEEAPLIIMLTQLREGK
EKCVHYWPTEEETYGPFRIRVQDVRERPEYTVRTLTIQHQEQRRALKHILFSAWPDHQTP
ESAGPLLRLVAEVEDGPETGARSGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILS
IVCQLRLDRGGMIQTAEQYQFLHHTLALFAAQLPEEPSP
Download sequence
Identical sequences G5E541
9913.ENSBTAP00000003923 ENSBTAP00000003923 ENSBTAP00000003923 XP_005217445.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]