SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003973 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003973
Domain Number 1 Region: 950-1244
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-76
Family Protein kinases, catalytic subunit 0.00000000143
Further Details:      
 
Domain Number 2 Region: 322-484
Classification Level Classification E-value
Superfamily L domain-like 8.22e-45
Family L domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 28-161,222-237
Classification Level Classification E-value
Superfamily L domain-like 2.33e-37
Family L domain 0.00000327
Further Details:      
 
Domain Number 4 Region: 482-602
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-23
Family Fibronectin type III 0.0000399
Further Details:      
 
Domain Number 5 Region: 767-910
Classification Level Classification E-value
Superfamily Fibronectin type III 3.35e-23
Family Fibronectin type III 0.00027
Further Details:      
 
Domain Number 6 Region: 604-672,773-795
Classification Level Classification E-value
Superfamily Fibronectin type III 3.93e-18
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 7 Region: 191-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000003
Family Growth factor receptor domain 0.0000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003973   Gene: ENSBTAG00000003054   Transcript: ENSBTAT00000003973
Sequence length 1301
Comment pep:known_by_projection chromosome:UMD3.1:3:14039800:14055462:1 gene:ENSBTAG00000003054 transcript:ENSBTAT00000003973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPSLWPWVACLLAILLSLGFGLDTREVCPSLDIRSDVAELRRLENCSVVEGHLQILLM
FTATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGARLFLGYALVIFEM
PHMRDVGLPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPSPGANHIVGNKLGEECADVC
PGLLGTTGEPCARTTFSGHTDYRCWTSSHCQKVCPCPRGLACTVRGECCHAECLGGCSRP
EDPRACVACRHLYFQGACHRACPPGTYQHESWRCVTAERCASLRSVPGRASTFGIHQGSC
LAQCPPGFTRNDSSIFCHKCEGLCPKECKVGTKTIDSVQAAQDLVGCTHVEGSLILNLRQ
GYNLELELQRSLGLVETITGFLKIKHSFALVSLGFFKNLKLIRGDTMVDGNYTLYVLDNQ
NLQQLGSWVAAGLTIPVGKIYFAFNPRLCLEHIYRLEEVTGTKGRQNKAEINPRTNGDRA
ACQTRTLRFVSNVTEANRILLRWERYEPLEARDLLSFIVYYKESPFQNATEYIGPDACGA
QSWNLLDVELPLSRTQEPGVTLAPLKPWTQYAVFVRAITLTTAEDSPHQGAQSPIVYLRT
LPAAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNITYYLVLWQRLAEDSDLYLNDYCHRG
LRLPTSNNDPRFDGEDGELEADREPGCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNA
ITIPKSPWKVTSINKSPQRDSGRSRRAAEALRLGGNSSDFKIQEDKVPRERAVLSGLRHF
TEYRIDIHACNHAAHTVGCSAATFVFARTMPHREADGIPGKVAWEAASKSSVLLRWLEPP
DPNGLILKYEIKYRRLGEEATVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGS
WTDSVAFYIPGPEEEDSGGLHVLLTVTPAGLMLLIILAVLGFFYSKKRNSTLYASVNPEY
FSASHMYIPDEWEVPREQISIIRELGQGSFGMVYEGLAQGLEVGEEPTPVALKTVNELAS
PRERIEFLKEASVMKAFKCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSHLRSLRPEAEN
NPGLPRPALGDMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDV
YETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQ
VLKFVVDGGVLEELESCPVQLQELMQRCWQQNPRLRPTFTHILDSIQEELRPSFRLLSFY
HSPECRGARASLLPTDAEPDSPRTPKEASSDFSPQNGGPGH
Download sequence
Identical sequences F1MC23
NP_001178164.1.59421 NP_001178164.1.76553 ENSBTAP00000003973 ENSBTAP00000003973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]