SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003980 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003980
Domain Number 1 Region: 493-780
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-79
Family Protein kinases, catalytic subunit 0.000000176
Further Details:      
 
Domain Number 2 Region: 62-182
Classification Level Classification E-value
Superfamily L domain-like 2.31e-22
Family Ngr ectodomain-like 0.00000183
Further Details:      
 
Domain Number 3 Region: 291-377
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000294
Family I set domains 0.0000127
Further Details:      
 
Domain Number 4 Region: 194-288
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000015
Family I set domains 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003980   Gene: ENSBTAG00000003060   Transcript: ENSBTAT00000003980
Sequence length 797
Comment pep:known_by_projection chromosome:UMD3.1:3:14019444:14037555:-1 gene:ENSBTAG00000003060 transcript:ENSBTAT00000003980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGGRGGQPGGHLRATGPGSLLAWLMLASAGAASCPDVCCPHGPSGLRCTRPGALDNLL
HLPGAENLTELYIENQQHLQQLKRSDLRGLGELRKLTIVKSGLRSVAPNAFHYTPRLGRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALLWLQRWEEEGRGGVREQKLQCPGQ
GPLALMSNASCGEPTLKIQMSNASVDVGADVLLQCQVEGQGLEQAGWILTELEGSATVME
SGSLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSAQVNVSFPASVHLQAAVEQHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLDLAANETMRHGCLRLNQPTHVNNGNYT
LLATNPLGQAAAWVMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKDETPFGVSMA
VGLAVFACLFLSTTFLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEG
KGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEKDKMLV
AVKALKEVSESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFL
RSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQG
LVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIF
TYGKQPWYQLSNTEPQAIECITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHA
RLQALAQAPPVYLDVLG
Download sequence
Identical sequences F1MC14
ENSBTAP00000003980 9913.ENSBTAP00000003980 ENSBTAP00000003980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]