SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003981 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003981
Domain Number 1 Region: 3485-3654
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-26
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 3291-3473
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.51e-25
Family Laminin G-like module 0.0071
Further Details:      
 
Domain Number 3 Region: 3084-3255
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.23e-22
Family Laminin G-like module 0.032
Further Details:      
 
Domain Number 4 Region: 2888-3078
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-16
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 5 Region: 2695-2876
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000547
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 6 Region: 1882-1932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000865
Family Laminin-type module 0.053
Further Details:      
 
Domain Number 7 Region: 1930-1985
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000698
Family Laminin-type module 0.0029
Further Details:      
 
Domain Number 8 Region: 660-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000893
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 9 Region: 524-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000949
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 10 Region: 1403-1451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 11 Region: 1542-1590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000195
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 12 Region: 1493-1544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 13 Region: 341-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000123
Family Laminin-type module 0.045
Further Details:      
 
Domain Number 14 Region: 282-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000146
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 15 Region: 1824-1876
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 16 Region: 723-761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 17 Region: 759-809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000753
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 18 Region: 1984-2028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 19 Region: 570-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 20 Region: 411-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 21 Region: 477-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 22 Region: 2031-2080
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000176
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number 23 Region: 812-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003981   Gene: ENSBTAG00000003061   Transcript: ENSBTAT00000003981
Sequence length 3656
Comment pep:known_by_projection chromosome:UMD3.1:13:55379959:55433278:1 gene:ENSBTAG00000003061 transcript:ENSBTAT00000003981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPAPLLLAGLALLGAARARAAGGGFSLHPPYFNLAEGARIAASATCGEEAPARGAPRPTE
DLYCKLVGGPVAGGDPNQTIQGQYCDICTAASSNRAHPVSNAIDGTERWWQSPPLSRGLE
YNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSTDFGHTYQPWQYFASSKRDCLER
FGLRTLERITQDDDVICSTEYSRIVPLENGEIVVSLVNGRPGAMNFSYSPLLRDFTKATN
IRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRCVCHGHADVCDAKDPTDPF
RLQCACQHNTCGGSCDRCCPGFNQQPWRPATTDSANECQSCNCYGHAHDCYYDPEVDRRN
ASQNQDQVYQGGGVCIDCQHHTTGINCEQCLPGFYRSPDHPLDSPHACRRCNCESDFTDG
TCEDLTGRCYCRPNFTGARCDACAEGFTDFPHCYPVPSSSHNDTGEQVLPAGHIVNCDCS
AAGTQGNACRKDPQVGHCVCKPNFQGTHCELCAPGFYGPGCQPCQCSSPGVVDGTCDRDS
GQCTCRTGFEGAACDRCAPGYFHFPLCQLCGCSPVGTLPEGCDDAGRCLCRPEFNGPHCD
RCRLGYHGYPECHACACDPRGSVDQLCGAGGLCRCCSGYAGSTCQECSPGFHGFPDCAPC
HCSPEGSLHAACDPHSGQCSCRPRVTGLRCDMCVPGAYNFPYCEAGSCHPAGLAPADRVP
PEAQAPCTCRAHVEGPSCDRCKPGFWGLSPSNPEGCTRCNCDPRGTLGGAAQCQLGNGQC
FCKPHVCGQTCAACKDGFFGLDQADYFGCRSCRCDVGGALGQSCELRTGACMCRPNTQGS
TCSEPAQDHYLPDLHHLRLELEEAATPEGHAVRFGFNPLEFENFSWRGYAQMTPIQPRIV
AQLNLTSPDLFRLVFRYVNRGPTSVSGRVSMRDQDKFTTCPNCTEQSQPVAFPPSTEPAF
VTVPQRGLGEPFVLNPGAWALLVEAEGVLLDYVVLLPSAYYEAALLQLRVTEPCTFRPDA
QRSGDNCLLYTHLPLDGFPSAAGPEALCRHDNSLPRPCPTEQLSPAHPPLVVCWGTDVDV
QLQVAVPQPGPYALVVEYANEDARQEVDVAVHTPQRAPQQGVLTLHPCSYRCVGSGSIRL
TAEQARFFLHSVTLVPTDTFSSEFVEPRVHCISSHGAFSPSSAACVPSRFPKPPQPVLLR
DCQVLPLPPGLPLTRSQELTPGAPPPGPQPRPPTAADPDAEPTLLRHPQGTVVFTTHVPA
LGRYAFLLHGYQPAHPTFAVEVLINGGRVWQGHANASFCPHGYGCRTLVVCEGRAILDVT
DSELTVTVRVPEGRWLWLEYVLVVPEEAYSSSYLREEPLDKSYDFISQCATHGYHISPSS
SSAFCRSAATSLSLFYNNGARPCGCHEVGAMSPTCEPFGGQCPCRAHVIGRDCSRCATGY
WGFPSCRPCDCSGRLCDELTGQCICPPRTIPPDCLVCQPQTFGCHPLVGCEECNCSGPGV
QELMDPTCDADSGQCKCRPNVAGRRCDTCAPGFHGFPSCRPCDCHEAGSAPGTCDPLTGQ
CYCKENVQGPRCDQCRLGTFSLDAANPKGCTRCFCFGATDRCRSSTYARREFVDMEGWTL
LSGDRQVVPHKRQEALMLRADLQRVPEAIPELYWQAPPSYLGDRVSSYGGTLRYELHSET
QRGDVFNPMESRPDVVLQGNQMSITFLEPVYPAPGDVHHGALQLVEGNFRHMETHSTVSR
EELMMVLAGLEQLHIRALFSQASSAVSLRRVALEVASEMGGGPPASNVELCMCPANYLGD
SCQECAPGYYRDVKGLFLGRCIPCQCHGHSDRCLPGSGVCIGCQHNTEGDHCERCQAGFV
RTGSEDPAAPCISCPCPLAVPSNNFATGCILRGGRTQCLCKPGYAGASCERCAPGFFGNP
LVLGSSCQPCDCSGNGDPNMLFSDCDPLTGTCRGCLRHTTGPRCESCAPGFYGNALLPGN
CTRCDCSPCGTEACDPHSGHCLCKAGVTGLRCDRCQEGHFGFEGCEGCRPCACGPAAESS
ECHPQSGQCHCRPGTGGPQCRECAPGHWGLPEQGCRRCQCQGGHCDLHTGRCTCPPGLGG
ERCETCSHQHQVPVPGGPGGHGVHCEVCDHCVVLLLDDLERAGALLPAIREQLSGINASS
VAWARLHRLNASITDLQNQLRSPPGPHYETTQQLEALERQTSSLGQDTQHLDGQATRARA
QAGQLLDSTEATLGRAQTLLAAIRAVDLALSELESQTDRLAPANASVPSGEQLRRVLAEV
ERLLQEIRARDLGVPRAAAEAELREAQRLLDRVQEQLTRRWERNQALVTHTRDRLAQYEA
GLMDLREALNRAVGTTREAEELNSRNQERLEEALQRKQELSGDNATLGATLQAARDTLAR
VSELLRGMDQAREEYEHLAASLDGARTPLLEKMHAFSPASSKLELVEAAEAHAWQLDQLA
LNLSSIIQGVNQDRFIQRAIEAANAYSSILQAVQAAEGAADQARQQANHTWAMVVQRGLA
PRARELLANSSALEEAILGEQRRLDLARATLQNTGTQLRDARARKEQLAARVREVQALLA
MDTDETSKKIAHAKAVAAEAQDTAARVQSQLQDMHRNVEQWQGQYKGLQSQDLGRVVLDA
GRSVSTLEKTLPQLLAKLNLLQDRGAHNASLALSASIGRVRELIAQARGAASKVKVPMKF
NGSSGVQLRTPRDLTNLASSTALKFYLQSPEPTAGQVTGDQFVLYMGGRQATGDYMGVAL
RGQRVHWVYRLGGAGPATLSIDEDIGEQFAAVSIDRILQFGRMSVTVENRMVQETKGDTV
APGAEGLLNVQPDDFVFYVGGYPSNFTPPEPLRFPGYRGCIELDTLNEEVVSLYNFEKTF
QLDTAVDKPCARSKSTGDPWLTDGSYLDGSGFARISMESQLSNTKRFDQELRLVSYSGII
FFLQHQDQFLCLAVQEGKLVLLYDFGAGLKEAGPLQQPPPQLTATSKAIQVFLLGGNRKR
VLVRVERTTVFSVEQENVLELADAYYLGGVPPSQLPASLRQLFPSGGSVRGCIKGIKALG
KYVDLKRLNTTGVSAGCTADLLVGRAMTFHGHGFLRLALPSDAVPLTGDVYSGFGFRSSQ
DSALLFQRESPGGPCEVTLQQGHVTLRLARTELKTQERFDDGAPHYVTFYSNSTGVWLYV
DDQLQEMKPYRGPRPQPQPEGPPQLLLGGSPKSSDIRNFSGCISNVFVLRLLGPQRVFDL
QENLGSFNVSSGCAPAPRTQLLEQVPQGLRATVSRKAARRSRQPAQDSACLPPGSLRTMR
DTYQFGGPLTSYLEFAHVPASPSDWSQLSMLVRPHAPRGLLLLAVPQTASSPSLVLFLNH
RRFVAQTEGPGPQLQVQSRQRSRTGQWHTVSVRWEKSRIQLMTDGVWAHSQEEPGRQHQR
QQGPRPHTLFVGGLPAGGHSPRLPVAISSPEFRGCVKRLRLDGRLLRAPTRMVGVTPCFS
GPLEKGLFFTGSGGTVTLDTLGATLPDVALELEVRPQTATGLVFHLGRGQTPPYLELQVL
GKQVLLWANDGAGEFSTLVTHPAALCDGRWHRLAVTKGGNVLRLEVDQQSNHTQGPAPAT
WANTLVPLHLGGLPEPWKRPHYNGCMRNLVLNQVSVTWPRTAGVQGAVGASGCPAT
Download sequence
Identical sequences F1MC13
ENSBTAP00000003981 ENSBTAP00000003981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]