SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004114 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004114
Domain Number 1 Region: 210-390
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-31
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 423-573
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000518
Family Nucleotide and nucleoside kinases 0.029
Further Details:      
 
Domain Number 3 Region: 2-40
Classification Level Classification E-value
Superfamily SAP domain 0.0000000044
Family SAP domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004114   Gene: ENSBTAG00000003168   Transcript: ENSBTAT00000004114
Sequence length 858
Comment pep:known chromosome:UMD3.1:18:50718845:50752307:1 gene:ENSBTAG00000003168 transcript:ENSBTAT00000004114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELEADDEPGRPGHN
NEEVETEGGSELEGTAQPPPPGLQPHPEPGGYSGPDGHYVMDNITMQNQFYETQVIKQEN
ESGYERRPLEIDQQQQAYRPEVKTEMKQEAPTSFLPPEASQHKPDRQQFQSRKRPYEENR
GRGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGF
AYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEP
FSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQ
KEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKA
ECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDV
LIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLK
DRTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGR
RAGPPPEKRFDNRGGGGFRGRGGGGGFQRYDNRGPPGGNRGGFQNRGGGSGGGGNYRGGF
NRSGGGGYNQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQPPPPQPPPQQPPPPPTYSP
ARNPPGASGYNKNSNIPGSSANTSTPPVSSYSPPQPSYSQPPPYNQGGYSQGYTAPPPPP
PPPPAYNYGSYGGYNPAPYTPPPPPAAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYG
NYDYGSYSGNTQGGTSTQ
Download sequence
Identical sequences A4FUC2
ENSBTAP00000004114 NP_001076935.1.59421 NP_001076935.1.76553 ENSBTAP00000004114 9913.ENSBTAP00000004114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]