SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004136 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004136
Domain Number 1 Region: 501-627
Classification Level Classification E-value
Superfamily TIMP-like 2.01e-27
Family Tissue inhibitor of metalloproteinases, TIMP 0.075
Further Details:      
 
Domain Number 2 Region: 332-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 3 Region: 262-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000691
Family Laminin-type module 0.064
Further Details:      
 
Domain Number 4 Region: 395-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000004136
Domain Number - Region: 97-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0255
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004136   Gene: ENSBTAG00000003183   Transcript: ENSBTAT00000004136
Sequence length 627
Comment pep:known chromosome:UMD3.1:5:60372425:60502966:-1 gene:ENSBTAG00000003183 transcript:ENSBTAT00000004136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCARLLLLWGCSAVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWTDTTCGQNATEL
YCFYSENTDLTCQQPKCDKCNAAQPHLAHLPAAMADSSFRYPRTWWQSAEDVHREKIQLD
LEAEFYFTHLIMVFKSPRPAAMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAI
CTSRYSNPFPCTGGEVIFRALSPPNDMENPYGAKVQEQLKITNLRVQLLKRQSCPCQRNH
LNAEPQHFTHYAIYDFIVKGSCFCNGHADQCIPIDGFRPVKAPGAFHVVHGKCICKHNTA
GTHCQHCAPLYNDRPWEAADGKTGSPNECRTCKCNGHADACHFDINVWEASGNRSGGVCN
DCQHNTEGQHCQRCKPGFYWDLRRPFSAPDACKSCSCHPVGSAVLPFSSVTFCDPSNGDC
PCKPGVAGPHCERCMVGYWGFGDYGCRPCDCAGSCDPHTGDCLSSTDIDWYHEVPDFHSM
HNKSEPTWDWKDEQGFSALRHSGKCECKEQVLGNSKAFCGMKYSYVLKIKILSAHDKGSH
AEVNVKIKKVLKSTKLKILRGKRTLYPESWTNRGCTCPILNPGLEYLVAGHEDVRTGKLV
VNMKSFVQHWKPSLGRKVMDILRRECK
Download sequence
Identical sequences A7MB18
NP_001095673.1.59421 NP_001095673.1.76553 ENSBTAP00000004136 ENSBTAP00000004136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]