SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004156 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004156
Domain Number 1 Region: 9-167
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.09e-28
Family Laminin G-like module 0.0062
Further Details:      
 
Domain Number 2 Region: 195-372
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-25
Family Laminin G-like module 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000004156
Domain Number - Region: 1021-1213
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00654
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004156   Gene: ENSBTAG00000003200   Transcript: ENSBTAT00000004156
Sequence length 2312
Comment pep:known chromosome:UMD3.1:20:24233178:24292919:1 gene:ENSBTAG00000003200 transcript:ENSBTAT00000004156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISLLTSFFPTASFYGESYVGLNIIEVSSELSLQLKFQTSKPQGLLFLAAGENDYCIVEIL
SGNLQVRVNLGTGELVRLSEQRLRVDDLAWHLVELYYVKDHVSLVIDKHYEMTGRITGGM
HNLHFQHGIYIAGHGGLEVSYLDGQLPNFRGCMEDVVFNQREILSSLRSYPGFKKVYEVS
LGCSDEFFAGEDEAINFFSSRSYVTFPEWKVQRDGLLEFALQTGTQQALLLFQSGREGDF
VALEIVEGFLKAHVGRDRSDTQLSSFSLVSDNQWHDIQLRFTERYLGLMVDEQRVRANLP
LQSKLFVSAGPLFVGGLDRHKGEEVKRLGLASVPGKSAGGISFKGCLRGLEANSEKRALK
DAFVSKDISAGCKMKGSDNENPSATTMEKLLLAEVPLSTADSEAGKPSLQDVRSYFLVLN
NLEVQEGGQALLEQRHMKVDMELKDLGIHQSQILFKIKEMPVYGFLRLDVSPEQGPEKVF
TLLDLEQGNVWYVHDGSEEPRDYFTFSVSSNSKREVPLYLQGHVSYVFNIVVIPVNDPPN
LKLPEGNLLLVFENSKKRLTPNIIHVSDPDTDSSSLSVSVLGNFNSDAGFLENINDPGRA
INGFSYGDLRDGNIFCVHRGHPNSRILLRANDGELVSSTVVLRVMAIPWDLAVANRTGVA
VQQGGSVLITQSNLSVEVNGERPEVDTRYVITYPPRFGQIQQQGPGGEWKQISTFSQRSV
DWSQIRYCTTFKDLQLENVMDHFKFKVDIEGKSSEELVFPITIQWLKFTLLKNVALEISK
IKRHVLNSDHLQAVTEGVEVPERELHFKLLTPPKKGKLLLGTEVLQTNSVFSQQNITDGK
ISYEPQERPREHSQDSFRFLMVAKHTESKGYTFRINFKAERRHIIVTNRGLLVKEGEGKL
ITKSELFAQTLDNRTFQYTVTKSPQHGKLKLIRSSDSPGNQDNITAFMDQDILGERLIYE
HDDSETQSDEFFLVASTAGPVQEGAFRDLDMEHLSMDIKVTISVELKNDEKPVRMVDKVF
HVVRNGQRLLTLSDICYHDPDSDFDDGQLLYIRRGIPNGDLVQASDPTQKLYQFRQEDLR
EGRVLFRHRGADSARFVLFVTDGVHYTSSLLEVSVSDPYIRVVNNTGLLVQRGKDSSLTT
ANLSVTTNQDVRTDHEVEFRIVQLPKHGRVLVSSSAPGSFSMHDLKQGCVIYRHDGSGSF
DMFNLTVRVKDTHLYVGVYVQVDSESHQHHTRILHSKTLVVEEGKPVKLSRGRLQAVHEH
PVPSEAVFIVRTPPVHGYLRRSLPEEGSVGTEEKFPLMFTQQDVDDGYIHYVQTMPDQQQ
DRFILDVMSGFQAVSRLEILVDIVPKRIPLAVQNFTVQEGGSKALPEDYFRIPSKHFEGL
DCEFVLLKPPKHGYVENSHFPRVKLMKFTRKQVENELISYVHDGSEALLDSFIIFANSSE
LGKQSLPQTLFVTVESVNDEAPVITANKILQVWVNSVAEITRDELCAVDGDSSPQDLAYL
VSPPSNGHLALKSIPGRSIQNFTQAQINEGQLVFVHNGAMSGGFNFQVTDGLNFAPRQIF
SITARALIISLEVNRGLSIFPGSVKPLSSRDLRAVTNDVDSAGNRTITFTVIRSPRLGRL
LRVNSDNSTEDVSVFTQNLVSEQLILYQHMDWENMGWTAEDSFTFTVSSPPAALGPEEFH
ITISYEINEPGRQSRLLANTGAVVKEGDKVLIDQSKLDASNLLLKLPKSQRSLYEIWFQV
TSLPHHGTLMVGERNITKRKPNFSQYIINTFGVTYLHDDSESLADNFTFAVWPNEKSKST
MKPEADFHEEMFNITITPINDQAPELKTKGLRLQVLQGNRFVLGPENLKVEDLDSPPEEI
RYVVIRDPNNGFLAMAHHPHIPVHHFTQADIDNSQVWFIHDGSPSSGAFYFSVSDGQHRP
LYKLFHLDVIPVSITLVNLTDLLLSQGQTSVTITGAHLSAVTNGRSPHVTYKVMRPLQHG
HLLIEDQEVVSFGQEDLNLGKLSYHMTNLTASEDQLQFSLFTSESNLTGQTLGIRVQPLL
RVSSGLTVANRVAHQLSRKDLDATELANRTNSDPTFEVTEPPVHSRLVRRAGWDTALEDA
TLFTQRDIDQGLLILEPHANLTGPNSLSDSFTFLLRADHVQPATGCLPFTIVPPDPFFSQ
TFTPNVSFLVTDNLVTIGVSQEKPVVSSEPTTQTGTLDATRASPGAPTQTRESSHPLMVI
MPLSVVLFLLIVTVVASCVWLLGRKAEKATPLIKPQINLEPTTAGPRPERSPTVPTVTVT
PLPRSSGSAPDPDMVKLCRQTNPALKHKQYWV
Download sequence
Identical sequences F1N084
ENSBTAP00000004156 9913.ENSBTAP00000004156 ENSBTAP00000004156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]