SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004272 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004272
Domain Number 1 Region: 273-431
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.96e-58
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000191
Further Details:      
 
Domain Number 2 Region: 111-270
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.91e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000762
Further Details:      
 
Domain Number 3 Region: 26-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000884
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 67-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000383
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004272   Gene: ENSBTAG00000003300   Transcript: ENSBTAT00000004272
Sequence length 431
Comment pep:known_by_projection chromosome:UMD3.1:21:20889913:20904968:-1 gene:ENSBTAG00000003300 transcript:ENSBTAT00000004272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCPRLLAALCGALFCSSGLFAFSGDFCDSSQCLHGGTCLLNEDRTPPFYCLCPEGFTGL
LCNETEHGPCFPNPCHNDAECQVTDDSHRGDVFIQYICKCPLGYVGIHCETTCTSPLGMQ
TGAIADSQISASSMHLGFMGLQRWAPELARLHQTGIVNAWTSGNYDKNPWIQVNLMRKMW
VTGVVTQGASRAGSAEYLKTFKVAYSTDGRQFQFIQVAGRSGDKIFIGNVNNSGLKINLF
DTPLETQYVRLVPIICHRGCTLRFELLGCELNGCTEPLGLKDNTIPNKQITASSYYKTWG
LSAFSWFPYYARLDNQGKFNAWTAQTNSASEWLQIDLGSQKRVTGIITQGARDFGHIQYV
AAYRVAYGDDGVTWTEYKDPGASESKIFPGNMDNNSHKKNIFETPFQARFVRIQPVAWHN
RITLRVELLGC
Download sequence
Identical sequences F1MXX6
9913.ENSBTAP00000004272 ENSBTAP00000004272 ENSBTAP00000004272 XP_015314666.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]