SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004298 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004298
Domain Number 1 Region: 75-355
Classification Level Classification E-value
Superfamily L domain-like 1.5e-50
Family Ngr ectodomain-like 0.002
Further Details:      
 
Domain Number 2 Region: 30-94
Classification Level Classification E-value
Superfamily L domain-like 0.00000218
Family Ngr ectodomain-like 0.0085
Further Details:      
 
Domain Number 3 Region: 404-480
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000189
Family Fibronectin type III 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004298   Gene: ENSBTAG00000003319   Transcript: ENSBTAT00000004298
Sequence length 649
Comment pep:known_by_projection chromosome:UMD3.1:13:8041873:8046999:-1 gene:ENSBTAG00000003319 transcript:ENSBTAT00000004298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISPAWSIFLIGTKIGLFLQVAPLSVMAKPCPSVCRCDAGFIYCNDRFLTSIPTGIPEDA
TTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTIT
YDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEEL
RLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAA
PVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQL
ILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFDCKDNPV
VSTIQITTGTPNTVHPAQGQWPAPVTKQPDTKNPKLTKDQRTTGIPSRKTITITVKSVTS
DTIHISWKLVLPMTALRLSWLKLDHSPAFGSITETIVTGERSEYLVTALEPDSPYRVCMV
PMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALV
TIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPIS
NEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS
Download sequence
Identical sequences F1N0R7
NP_001179603.1.59421 NP_001179603.1.76553 XP_005214137.1.76553 XP_005214138.1.76553 XP_010809351.1.76553 XP_010842444.1.44457 XP_010842445.1.44457 XP_010842446.1.44457 XP_019828455.1.53367 XP_019828456.1.53367 ENSBTAP00000004298 ENSBTAP00000004298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]