SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004564 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004564
Domain Number 1 Region: 173-373
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1e-56
Family Prokaryotic proteases 0.00000146
Further Details:      
 
Domain Number 2 Region: 386-481
Classification Level Classification E-value
Superfamily PDZ domain-like 9.2e-22
Family HtrA-like serine proteases 0.0015
Further Details:      
 
Domain Number 3 Region: 38-125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000706
Family Growth factor receptor domain 0.003
Further Details:      
 
Domain Number 4 Region: 110-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000373
Family Ovomucoid domain III-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004564   Gene: ENSBTAG00000019532   Transcript: ENSBTAT00000004564
Sequence length 484
Comment pep:known chromosome:UMD3.1:27:33780037:33795791:1 gene:ENSBTAG00000019532 transcript:ENSBTAT00000004564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPLQRPAGLGPFVLLWLLLPAPSGRGVQAGRAWPVPRCPAACEPTRCPPLPRCSVGTA
PVLDRCGCCRVCAAAEGEACGGPLGRPCAPGLQCLAPRAPRLLGGRPLGTCGCPAAGATV
CGSDGRTYRSLCALRAENRAARLRGALPAVPVQKGDCGDPGTGSAGWLRNKFNFIASVVE
KVAPSVVHLQLFRRDRSPLGSEDVPVSSASGFIVSEDGLIVTNAHVLTNQQRIQVELQSG
VQYEATVKDVDHKLDLALIKIEPNADLPVLLLGKSSDLRAGEFVVALGSPFSLQNTVTAG
IVSTTQRGGKELGLKDSDMDYIQTDAIINHGNSGGPLVNLDGDVIGINTLKVTAGISFAI
PSDRIRQFLAEFHERQLKGKALSQKKYLGLRMLPLTMNLLQEMKRQDPEFPDVASGVFVH
EVIQGTAAESSGLKDHDVIVSINGLPVTTTTDVIEAVKANDSLSLLVRRKSQTLILTVTP
EIIN
Download sequence
Identical sequences E1BJW1
ENSBTAP00000004564 9913.ENSBTAP00000004564 ENSBTAP00000004564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]