SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004588 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004588
Domain Number 1 Region: 90-218
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000004
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 41-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000131
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004588   Gene: ENSBTAG00000003528   Transcript: ENSBTAT00000004588
Sequence length 658
Comment pep:novel chromosome:UMD3.1:7:11786311:11831715:1 gene:ENSBTAG00000003528 transcript:ENSBTAT00000004588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CALRCPPNSSCVNGTACRCAPGFISFSGEIFTDPLESCDGINECGPPSPVYCGSSADCQN
TEGGYYCTCSPGYEPVSGAMIFRNESENTCRDVDECQHRPRVCKGLSVCINTEGSYTCQC
PPGLEFSPEDPRHCTDVNECTSGKKPCHSSTHCLNSMGSYECRCRSGWKPIGPPNGPHNT
VCEDVDECSSRQHQCHNSTVYVNTVGSYTCHCRQGWEPKPGFWDKQMNTICKEISFPTWT
APSGIKSQALSHFLNRIQDLGRNFSSASVLNTVQDLVQETGDLLETPGDLKTLPFSEQHF
VVTNLLFGLENVLRGVSKALPKGSFTFNSSAGIELSLEVQVPSYRNITLIQKQTKMMLTW
DTVHDSGDSGLAVVGLLSTPGMDRFLAEAPLVLDAEELTTLREIHRGLLQETSHILLSDV
ISAFITNKDTENLRSPVTFVFQHVGPDGMEWLTQSVTPGPREKVHCVYWEHGQNGSGHWD
TRGCWVTSTRDNSTTCQCSHLSIFAVLMAHYSVQEEDPALTVITYVGLSLSLLCLLLVVL
TFLLCKAIQNTSTSLHLQLSLCLFLAHLLFLTAIDRTESKVKLVLCAIIAGALHYLYLAS
FTWMLLVGLHLFLSARNLTVVNYSGINRFMKKAMFPVGYGVPAVIVAISAASRPHLYG
Download sequence
Identical sequences G5E558
ENSBTAP00000004588 ENSBTAP00000004588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]