SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004800 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004800
Domain Number 1 Region: 36-291
Classification Level Classification E-value
Superfamily L domain-like 6.8e-47
Family Ngr ectodomain-like 0.037
Further Details:      
 
Domain Number 2 Region: 284-375
Classification Level Classification E-value
Superfamily Immunoglobulin 5.62e-19
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004800   Gene: ENSBTAG00000003684   Transcript: ENSBTAT00000004800
Sequence length 465
Comment pep:known chromosome:UMD3.1:21:51772760:52095083:1 gene:ENSBTAG00000003684 transcript:ENSBTAT00000004800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFLFYLFFIGIAVKAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLAD
NFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFS
GLSNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDH
NMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGN
PLHCNCELLWLRRLSREDDLETCASPALLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLE
GQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYENGTLDILITTVKDTGAFTCIAS
NPAGEATQTVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNASSSNGDTKMSQDK
IVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRGRS
Download sequence
Identical sequences A2VDW1
ENSBTAP00000004800 ENSBTAP00000004800 NP_001075079.1.59421 NP_001075079.1.76553 9913.ENSBTAP00000004800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]