SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004833 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004833
Domain Number 1 Region: 142-385
Classification Level Classification E-value
Superfamily vWA-like 6.27e-77
Family Integrin A (or I) domain 0.000000579
Further Details:      
 
Domain Number 2 Region: 386-472
Classification Level Classification E-value
Superfamily Integrin domains 1.46e-21
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 3 Region: 44-102
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000022
Family Plexin repeat 0.00093
Further Details:      
 
Domain Number 4 Region: 590-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family Integrin beta EGF-like domains 0.006
Further Details:      
 
Domain Number 5 Region: 546-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Integrin beta EGF-like domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004833   Gene: ENSBTAG00000003709   Transcript: ENSBTAT00000004833
Sequence length 767
Comment pep:known chromosome:UMD3.1:4:29124581:29216280:1 gene:ENSBTAG00000003709 transcript:ENSBTAT00000004833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRSALVFFTATLVCLQNCRPGPVPFLRAAWMFSVVLGLGQSEDNRCASSNAVSCTKCLA
LGPECGWCAQEDFISGGSKNERCDTVSNLIHKGCSIDLIEYPSVRVMPSENEINTQVTPG
EVLIQLHQGAEANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFS
RDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAV
HRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVV
PNDGNCHLKNNVYVRSTSMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGT
IAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVKGIYFNITAICPDGTRKPGTDGCGN
VTSNDEVLFNVTVTMEKCDVTGGKSYAIIKPIGFNETTKIHIHRNCSCQCDDSRGPKRKC
VEETFLDTKCFQCDENKCHIDEDTFPSESCKSHKDQPVCSGRGVCICGKCLCHKIKFGKV
YGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFRGWEGDRCQCPSASAQLCVSPKGQVC
SGRGTCVCGRCECTDPRSIGRFCEHCPTCHTGCSENWNCVQCLHPHNLSQAILDRCKTSC
ALKEQHYVDQTSECLSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNNNKIKSSADY
RVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
Download sequence
Identical sequences F1MVW3
ENSBTAP00000004833 NP_001179804.1.59421 NP_001179804.1.76553 XP_019814081.1.53367 ENSBTAP00000004833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]