SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004836 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004836
Domain Number 1 Region: 244-346
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.77e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 95-202
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000117
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 11-72
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000135
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004836   Gene: ENSBTAG00000003711   Transcript: ENSBTAT00000004836
Sequence length 870
Comment pep:known chromosome:UMD3.1:11:28576347:28668899:1 gene:ENSBTAG00000003711 transcript:ENSBTAT00000004836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEADADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNNCPPHSSLCGCKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRITELVGYHPQELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SPFKPHLLTMNSIFDNSGKVAVSEKSNFLFTKLKEEPEELAQLAPTAGDTIISLDFGTPN
FEESSAYGKGILPPGQQWTGEVKSHGTHSEAGSLPAFTVPQAAALGNSTPSASSSSSCST
PSSPGDYYTSLDDNLKIEAIEKLFAMDTEAKDQCGTQTDFNELDLETLAPYIPMDGEDFQ
LSPICPEESLLPETPQSAPQHCFSTMSNIFQPLAPMASHSTFLLDKYQQQLESKKTEPEQ
RRVSFAFFDGGSRVSLLQCCGQTYTPLSSMGGISNTQWPPDPPLQLGPTKWPGEDRHAEA
VGAAPLGLPPATPHLAMLKKRSAKGFGPQGPDVMSPAMIALSNKLKLKRQLEYEEQAFQD
MSGGDPPGSSTSHLMWKRMKSLRGGGTCSLMPDKLPNANVPNDEFIQNPVRGRSQPLRHL
SPPQPPSATSPGEPTKSGFPAQCYAPQYQDYSLPAAHKMSGMASRLLGPSFEPYLLPELT
RYDCEVNVPVPGTSTLLQGGDLLRALDQAT
Download sequence
Identical sequences A5PJT1
ENSBTAP00000004836 9913.ENSBTAP00000004836 ENSBTAP00000004836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]