SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004913 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004913
Domain Number 1 Region: 544-589
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000693
Family TSP-1 type 1 repeat 0.00087
Further Details:      
 
Domain Number 2 Region: 71-145,196-209,497-536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000282
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 40-88
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000628
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004913   Gene: ENSBTAG00000003774   Transcript: ENSBTAT00000004913
Sequence length 589
Comment pep:known chromosome:UMD3.1:3:89797014:89869019:-1 gene:ENSBTAG00000003774 transcript:ENSBTAT00000004913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAAAFFLLFLMTYQPGVTIQEKVNWRVSRAVQSFTPTAVSCQLDNWAEWTDCFPCQDKK
YRYRSLLQPNKFGGTICSGNVWDQASCHSPTACLSQAQCGQDFQCKETGRCLKRHLVCNG
DKDCLDGSDEDDCEDVRILENDCSQYDPIPGSEKAALGYNILTQEEAQHVYDARYYGGQC
ETVYNGEWRELQYDPACERLYYGDDDKYFRKPYNFLKYHFEAQADTKISSEIYNDANDLL
TKVKNDKSVSSGLTIGVGIRGVPVTVTAGVSMSKDAAFLKKLSKYHEKKYSFMRIFTKVQ
TAHFKMRRENIVLDEGMLQSLMELPERYHYGMYAKFINDYGTHYITSGSMGGVYEYILVL
NREKMETAGVTSAEIQKCFGVSLGIEYEYSEAIQIKGSSSLGPCKKSGDGKLTENEKAMG
VEDFISRVRGGSSGWGGSLTQDSSLVTYRSWGRSLKYNPAVIDFEMKPIHEILQHTNLGS
LETKRQNLRRALDKYLMEFNACRCGPCFNNGEPILEGTSCKCQCPVGHQGLACEQMQSEG
AQADGRWSCWSSWSACRSGTQERRRECNNPAPQNGGASCPGHRVQTQAC
Download sequence
Identical sequences F1MX87
ENSBTAP00000004913 9913.ENSBTAP00000004913 ENSBTAP00000004913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]