SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004933 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004933
Domain Number 1 Region: 174-448
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.01e-94
Family Transglutaminase core 0.000000000245
Further Details:      
 
Domain Number 2 Region: 480-656
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.42e-60
Family Extended PAW domain 0.0000000651
Further Details:      
 
Domain Number 3 Region: 16-118
Classification Level Classification E-value
Superfamily PUG domain-like 6.8e-32
Family PUG domain 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004933   Gene: ENSBTAG00000003793   Transcript: ENSBTAT00000004933
Sequence length 657
Comment pep:known_by_projection chromosome:UMD3.1:27:39876196:39934374:1 gene:ENSBTAG00000003793 transcript:ENSBTAT00000004933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAALGGSAGSASPAVAELCQNTPETFLEASRLLLTYADNILRNPNDEKYRSIRIG
NTTFSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIERSSRLDGSE
KSHKTELSQHLAASSQLPTAPSSHPDGVTQPPGNSEGQASRPPVAPMVADNSVILKVLRS
NIQHVLVYENLALQEKALACIPVQELKRRSQEKLSRARKLDKGTNVSEEDFLLLELLHWF
KEEFFHWVNDIVCSKCGGQTKSRGESLLPSEEELKWGANRVEDHYCDTCQLSNRFPRYNN
PEKLLETRRGRCGEWANCFTLCCRALGFEARYVWDYTDHVWTEVYSPSQQRWLHCDSCED
VCDKPLLYEVGWGKKLSYIIAFSKDEVVDVTWRYSCKHEEVISRRTEIKEEVLRETINGL
NKQRQVSLSENRKKELLQRIVVELVEFISPRSPQPGELGGRTSGSLAWRLARGEAGPESK
ETLFIPSENEKISKQLHLCYNIVKNYYVRISSNNQTISGWENGVWRMESIFRKVETDWNM
VYLARKEGSSYAYISWKFECGSVGLKVDSISIRTSSQTFETGTVQWKLRSDTAQAELTGD
KTLRSYHDFSGATEVTLEAKLSRGDGVVAWQHTQLFRQSLNDHEENCLEIIIKFSDL
Download sequence
Identical sequences E1BKB2
9913.ENSBTAP00000004933 ENSBTAP00000004933 NP_001179716.1.59421 NP_001179716.1.76553 ENSBTAP00000004933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]