SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005002 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005002
Domain Number 1 Region: 38-143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-16
Family Growth factor receptor domain 0.002
Further Details:      
 
Domain Number 2 Region: 147-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000379
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005002   Gene: ENSBTAG00000003837   Transcript: ENSBTAT00000005002
Sequence length 262
Comment pep:known_by_projection chromosome:UMD3.1:3:108854245:108874912:1 gene:ENSBTAG00000003837 transcript:ENSBTAT00000005002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGLCVVALVLSWMHLAAGSRGIKGKRQRRISADGGQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQESLYL
HKGRCYPACPEGSAPADGTMECSSPAQCEMSEWSLWGPCSKKKKLCGFRRGLEERTRRVL
HAPGGDHAVCSDTKETRKCTVRRTPCPEGQKRRKGSQGRRENANRNPGRKESKEAGTGAR
RRKGQQQQQQGTEGPVTSLGPT
Download sequence
Identical sequences F1ME23
ENSBTAP00000005002 9913.ENSBTAP00000005002 XP_005204757.1.76553 ENSBTAP00000005002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]