SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005069 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005069
Domain Number 1 Region: 84-140
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-18
Family Fibronectin type II module 0.001
Further Details:      
 
Domain Number 2 Region: 52-96
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000223
Family Fibronectin type II module 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005069   Gene: ENSBTAG00000003886   Transcript: ENSBTAT00000005069
Sequence length 140
Comment pep:known chromosome:UMD3.1:18:51917197:51920523:1 gene:ENSBTAG00000003886 transcript:ENSBTAT00000005069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRLGLFLIWAGVSMFLQLDPVNGDEQLSEDNVILPKEKKDPASGAETKDNKCVFPFIY
GNKKYFDCTLHGSLFLWCSLDADYTGRWKYCTKNDYAKCVFPFIYEGKSYDTCIIIGSTF
MNYWCSLSSNYDEDGVWKYC
Download sequence
Identical sequences P04557
9913.ENSBTAP00000005069 NP_777265.1.59421 NP_777265.1.76553 ENSBTAP00000005069 ENSBTAP00000005069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]