SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005163 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005163
Domain Number 1 Region: 227-469
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.06e-81
Family Eukaryotic proteases 0.0000000694
Further Details:      
 
Domain Number 2 Region: 63-118
Classification Level Classification E-value
Superfamily GLA-domain 2.86e-22
Family GLA-domain 0.00027
Further Details:      
 
Domain Number 3 Region: 157-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000263
Family EGF-type module 0.0017
Further Details:      
 
Domain Number 4 Region: 120-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000782
Family EGF-type module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005163   Gene: ENSBTAG00000003950   Transcript: ENSBTAT00000005163
Sequence length 480
Comment pep:known_by_projection chromosome:UMD3.1:2:5034439:5044966:-1 gene:ENSBTAG00000003950 transcript:ENSBTAT00000005163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGQPCSFSAAHPSGCSFRMWQLTSLLLFVTIWGISSTPAPPDSVFSSSQRAHQVLRI
RKRANSFLEELRPGNVERECSEEVCEFEEAREIFQNTEDTMAFWSKYSDGDQCEDRPSGS
PCDLPCCGRGKCIDGLGGFRCDCAEGWEGRFCLHEVRFSNCSAENGGCAHYCMEEEGRRH
CSCAPGYRLEDDHQLCVSKVTFPCGRLGKRMEKKRKTLKRDTNQVDQKDQLDPRIVDGQE
AGWGESPWQAVLLDSKKKLVCGAVLIHVSWVLTVAHCLDSRKKLIVRLGEYDMRRWESWE
VDLDIKEVIIHPNYTKSTSDNDIALLRLAKPATLSQTIVPICLPDSGLSERKLTQVGQET
VVTGWGYRDETKRNRTFVLSFIKVPVVPYNACVHAMENKISENMLCAGILGDPRDACEGD
SGGPMVTFFRGTWFLVGLVSWGEGCGRLYNYGVYTKVSRYLDWIYGHIKAQEAPLESQVP
Download sequence
Identical sequences A0A140T851
NP_001159984.1.59421 NP_001159984.1.76553 XP_010800088.1.76553 ENSBTAP00000005163 ENSBTAP00000005163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]